Recombinant Full Length Petrotoga Mobilis Atp-Dependent Zinc Metalloprotease Ftsh 3(Ftsh3) Protein, His-Tagged
Cat.No. : | RFL9206PF |
Product Overview : | Recombinant Full Length Petrotoga mobilis ATP-dependent zinc metalloprotease FtsH 3(ftsH3) Protein (A9BJK3) (1-645aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Petrotoga mobilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-645) |
Form : | Lyophilized powder |
AA Sequence : | MQNKRNQSRVLWLLLIYITIGIFIYVGVNSLIGTPDVSKIEYSELVQMLEDKKIVSLEIE DSGYARARDNRGLYYETYAPTLLSDQQYVYGLANQGIEIKYVRSLENSWWISILTFLLPV FLLIFLFTFLFRSSGGGANQGMNFIKSPAKKYDPKKTRTTFNDVAGVKEAKEELTDVVKF LKDPKVFNRLGARMPKGVLLVGEPGTGKTLLARAVAGEAGVPFFYISGSDFVELFVGVGA ARVRDLFNQAKANAPAIIFIDEIDAVGRQRGSGLGGGHDEREQTLNSILVEMDGFDPSIG IIVMAATNRPDVLDKALLRPGRFDKKVVIDRPDAEGRKDILKIHFRGKKIAPDVDLEVLA RATPGFVGADLENLVNEAALLAARNGEKFITMKDCEEAIERVIVGPERKTRVLSEQEKEV VAYHELGHAILGTILPNADPVHKVTIIPRGYAALGYTLQLPSEDRYLMNKSEILDDIAVM LAGRAAEEIIFDEITSGAENDLKRATEMARRMVESFGMSEKIGPVAWASESEETFLAREL FREKNYSDETAKELDSEVKQIINKSYEKAKSVLLENKEKLQFIAQYLLKKETISGQELRD LLQKDTDDLKEYVENLGVSSTQEEAKVVNYEYLSRENNLIERKGI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH3 |
Synonyms | ftsH3; Pmob_0873; ATP-dependent zinc metalloprotease FtsH 3 |
UniProt ID | A9BJK3 |
◆ Recombinant Proteins | ||
SMARCB1A-1690Z | Recombinant Zebrafish SMARCB1A | +Inquiry |
RFL27527CF | Recombinant Full Length Canis Lupus Atp Synthase Subunit A(Mt-Atp6) Protein, His-Tagged | +Inquiry |
PRSS36-2632H | Recombinant Human PRSS36 Protein, His-tagged | +Inquiry |
PPIP5K1-13788H | Recombinant Human PPIP5K1, His-tagged | +Inquiry |
SPIB-811H | Recombinant Human SPIB | +Inquiry |
◆ Native Proteins | ||
MMP2-46H | Native Human MMP-2 | +Inquiry |
Trf-70M | Native Mouse Apotransferrin | +Inquiry |
20S Immunoproteasome-225C | Active Native Cynomolgus monkey 20S Immunoproteasome protein | +Inquiry |
Collagen-62B | Native Bovine Collagen Type XI | +Inquiry |
C3-05M | Native Mouse C3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RGS19-2380HCL | Recombinant Human RGS19 293 Cell Lysate | +Inquiry |
DENND1B-465HCL | Recombinant Human DENND1B cell lysate | +Inquiry |
HSD17B4-5373HCL | Recombinant Human HSD17B4 293 Cell Lysate | +Inquiry |
IVD-001HCL | Recombinant Human IVD cell lysate | +Inquiry |
LRRC18-4646HCL | Recombinant Human LRRC18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ftsH3 Products
Required fields are marked with *
My Review for All ftsH3 Products
Required fields are marked with *
0
Inquiry Basket