Recombinant Full Length Petromyzon Marinus Pineal Opsin Protein, His-Tagged
Cat.No. : | RFL25884PF |
Product Overview : | Recombinant Full Length Petromyzon marinus Pineal opsin Protein (O42490) (1-444aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Petromyzon marinus (Sea lamprey) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-444) |
Form : | Lyophilized powder |
AA Sequence : | MDALQESPPSHHSLPSALPSATGGNGTVATMHNPFERPLEGIAPWNFTMLAALMGTITAL SLGENFAVIVVTARFRQLRQPLNYVLVNLAAADLLVSAIGGSVSFFTNIKGYFFLGVHAC VLEGFAVTYFGVVALWSLALLAFERYFVICRPLGNFRLQSKHAVLGLAVVWVFSLACTLP PVLGWSSYRPSMIGTTCEPNWYSGELHDHTFILMFFSTCFIFPLAVIFFSYGKLIQKLKK ASETQRGLESTRRAEQQVTRMVVVMILAFLVCWMPYATFSIVVTACPTIHLDPLLAAVPA FFSKTATVYNPVIYIFMNKQFRDCFVQVLPCKGLKKVSATQTAGAQDTEHTASVNTQSPG NRHNIALAAGSLRFTGAVAPSPATGVVEPTMSAAGSMGAPPNKSTAPCQQQGQQQQQQGT PIPAITHVQPLLTHSESVSKICPV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Petromyzon marinus Pineal opsin |
Synonyms | Pineal opsin; Pineal gland-specific opsin; P-opsin |
UniProt ID | O42490 |
◆ Recombinant Proteins | ||
YHDF-0894B | Recombinant Bacillus subtilis YHDF protein, His-tagged | +Inquiry |
FAS-2664H | Active Recombinant Human FAS protein, hFc&His-tagged | +Inquiry |
Envelope-753H | Recombinant Human T cell Leukemia Virus Type-1 Envelope Protein | +Inquiry |
AMDHD1-1095H | Recombinant Human AMDHD1 Protein (1-426 aa), His-SUMO-tagged | +Inquiry |
FGF23-29H | Recombinant Human FGF23(R179Q) protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen type I & III-185 | Native Porcine Collagen type I & III Protein | +Inquiry |
Thrombin-23B | Native Bovine Thrombin | +Inquiry |
AMY1A-8023H | Native Human Salivary Amylase (Alpha) | +Inquiry |
Cysteine-01C | Native Clostridium histolyticum Cysteine (C41, heavy chain) | +Inquiry |
Lectin-1741M | Active Native Musa Paradisiaca (Banana) Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM14B-998HCL | Recombinant Human TMEM14B 293 Cell Lysate | +Inquiry |
PTBP1-2728HCL | Recombinant Human PTBP1 293 Cell Lysate | +Inquiry |
ATG5-8622HCL | Recombinant Human ATG5 293 Cell Lysate | +Inquiry |
Skin-744R | Rabbit Skin Lysate, Total Protein | +Inquiry |
ZMAT2-1984HCL | Recombinant Human ZMAT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Petromyzon marinus Pineal opsin Products
Required fields are marked with *
My Review for All Petromyzon marinus Pineal opsin Products
Required fields are marked with *
0
Inquiry Basket