Recombinant Full Length Penicillium Marneffei Probable Endonuclease Lcl3(Lcl3) Protein, His-Tagged
Cat.No. : | RFL19421TF |
Product Overview : | Recombinant Full Length Penicillium marneffei Probable endonuclease lcl3(lcl3) Protein (B6QNP4) (1-344aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Talaromyces marneffei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-344) |
Form : | Lyophilized powder |
AA Sequence : | MGWWSLGSSGSKADPEKSKANDSKSSNRRQQEEGEQSFIPPPLTSRTSSSSSSKSTTDWN SSLNAFDWSQFKQPRNLIPTALLTGGILFVVYVQRRYLRRFPEATDISSSYFRSRSLLGR VTSVGDGDNFRIFHTPGGRLVGWGWLPWMKVPTARKELKDKTVHIRLAGVDAPELAHFGR PAQPYAYEAHMWLTSYLMNRRVRAYVHRPDQYKRVIATVYVRRWLDFPPLRRRDVSYEML RRGLATVYEAKSGVEFGGTENERKYREAEMLAKNRRQGLWKDFGKRGGVNFESPREYKTR MQSLDMSAESSSSSSSSSNTEKNPGLVGSLLRKVWPFGSKKDGT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lcl3 |
Synonyms | lcl3; PMAA_053390; Probable endonuclease lcl3 |
UniProt ID | B6QNP4 |
◆ Native Proteins | ||
Chylomicrons-192H | Native Human Chylomicrons | +Inquiry |
KNG1-29146TH | Native Human KNG1 | +Inquiry |
PGK-100Y | Active Native Yeast 3-Phosphoglyceric Phosphokinase | +Inquiry |
Amyloid P native protein-3441H | Native Human Amyloid P native protein | +Inquiry |
Lectin-1780G | Active Native Griffonia Simplicifolia Lectin I Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEF2D-4374HCL | Recombinant Human MEF2D 293 Cell Lysate | +Inquiry |
ZNF187-129HCL | Recombinant Human ZNF187 293 Cell Lysate | +Inquiry |
CSF2RB-1137RCL | Recombinant Rat CSF2RB cell lysate | +Inquiry |
UBA1-420HCL | Recombinant Human UBA1 cell lysate | +Inquiry |
C14orf28-209HCL | Recombinant Human C14orf28 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lcl3 Products
Required fields are marked with *
My Review for All lcl3 Products
Required fields are marked with *
0
Inquiry Basket