Recombinant Full Length Pelodictyon Phaeoclathratiforme Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL25294PF |
Product Overview : | Recombinant Full Length Pelodictyon phaeoclathratiforme ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (B4SCV5) (1-662aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pelodictyon phaeoclathratiforme |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-662) |
Form : | Lyophilized powder |
AA Sequence : | MSENPVKRPGKDGSRNKFKPVQEEGGTPGWFRSKGESPQGKFPGFLLFLMAGLLMLFVFL RFFSGTDAPEITYNEYKSVLSRALVTEVTVKTYEDKSAILSGKLNAPAQLQLIDKTTLQT NRFAVRVPSFTLEQADMLTEKGVRLKVEKGSSDLNTFLALFAPWIIFAALYFFLFRRMSG QNGAQAKNIFSFGKSRAKMVSEFEVKTTFKDVAGVDEAIEELQETVEFLTNPEKFQKIGG KIPKGVLLLGPPGTGKTLLAKAIAGEAKVPFFSISGADFVEMFVGVGAARVRDLFEQAKK NAPCIIFIDEIDAVGRSRGAGLGGGHDEREQTLNQLLVEMDGFTTNENVILIAATNRPDV LDSALLRPGRFDRQITIDKPDIRGREAILKIHTRNTPLDGDVDITVLAKSSPGFSGADLA NLVNEAALLAARHEQVLITAVNFEQARDKILMGPERRSMFISDEQKKLTAYHEAGHVLVS IHTKGSDPIHKVTIIPRGRSLGLTAYLPLEDRYTHNREYLLAMITYALGGRVAEELVFQE CSTGAANDIEKATDIARRMVRQWGMSESLGPINYGDSHKEVFLGKDYSHIREYSEETALQ IDVEVRNIIMGCMENAKTVLSEQLAVLHRLAGILIEKESLNAREIQEITGPGQGALPNPV TA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; Ppha_0463; ATP-dependent zinc metalloprotease FtsH |
UniProt ID | B4SCV5 |
◆ Recombinant Proteins | ||
HSD17B13-4841HFL | Recombinant Full Length Human HSD17B13, Flag-tagged | +Inquiry |
UPK3A-6545H | Recombinant Human UPK3A Protein (Phe15-Ile211), His tagged | +Inquiry |
YIF1B-18659M | Recombinant Mouse YIF1B Protein | +Inquiry |
CSF2-4034H | Recombinant Human CSF2 Protein (Met1-Glu144), C-His tagged | +Inquiry |
IRF2BP2B-12774Z | Recombinant Zebrafish IRF2BP2B | +Inquiry |
◆ Native Proteins | ||
TG-22P | Native Porcine Thyroglobulin (TG) Protein | +Inquiry |
LYZ-29007TH | Active Native Human LYZ | +Inquiry |
FSH-1564H | Active Native Human Follicle Stimulating Hormone | +Inquiry |
Hemocyanin-031H | Native Helix pomatia Hemocyanin Protein | +Inquiry |
CTSH-27404TH | Native Human CTSH | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM133-1005HCL | Recombinant Human TMEM133 293 Cell Lysate | +Inquiry |
EIF5A2-6640HCL | Recombinant Human EIF5A2 293 Cell Lysate | +Inquiry |
CDH15-1484RCL | Recombinant Rat CDH15 cell lysate | +Inquiry |
COLGALT2-482HCL | Recombinant Human COLGALT2 cell lysate | +Inquiry |
RAB8A-2580HCL | Recombinant Human RAB8A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket