Recombinant Full Length Pelobacter Propionicus Cobalt Transport Protein Cbim 2(Cbim2) Protein, His-Tagged
Cat.No. : | RFL33298PF |
Product Overview : | Recombinant Full Length Pelobacter propionicus Cobalt transport protein CbiM 2(cbiM2) Protein (A1ANE2) (1-226aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pelobacter propionicus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-226) |
Form : | Lyophilized powder |
AA Sequence : | MHIMEGFLPVEHAIGWSVASAPVVAYGLYSINKKIKKNPEQRMLLGVAAAFTFVLSALKM PSVTGSCSHPTGTGLGAILFGPSAVAPIGAVVLLFQALLLAHGGLTTLGANIFSMAIVGP FAAAAVFRLARAARFPFGVGVFLAASLGDLLTYVTTACQLAFAFPDPVGGFTASLAKFAG VFALTQIPLAISEGLLTVVVMNALLRFNREELGSLNIEGNGQEVQA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cbiM2 |
Synonyms | cbiM2; Ppro_1241; Cobalt transport protein CbiM 2; Energy-coupling factor transporter probable substrate-capture protein CbiM 2 |
UniProt ID | A1ANE2 |
◆ Recombinant Proteins | ||
Kit-4038MF | Recombinant Mouse Kit Protein, His-tagged, FITC conjugated | +Inquiry |
RFL31074SF | Recombinant Full Length Staphylococcus Haemolyticus Sensor Protein Kinase Walk(Walk) Protein, His-Tagged | +Inquiry |
ASPH-8165Z | Recombinant Zebrafish ASPH | +Inquiry |
PGCM-2576B | Recombinant Bacillus subtilis PGCM protein, His-tagged | +Inquiry |
RLN1-4714R | Recombinant Rat RLN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CA 72-4-379H | Active Native Human Cancer Antigen 72-4 | +Inquiry |
IgG-151M | Native Mouse IgG Fab fragment | +Inquiry |
NFL-01P | Native Pig NFL Protein (549 AA) | +Inquiry |
AC-62H | Native Human Activated Protein C | +Inquiry |
HP-26196TH | Native Human HP | +Inquiry |
◆ Cell & Tissue Lysates | ||
NGF-001MCL | Recombinant Mouse NGF cell lysate | +Inquiry |
POP5-3010HCL | Recombinant Human POP5 293 Cell Lysate | +Inquiry |
SAP30-1559HCL | Recombinant Human SAP30 cell lysate | +Inquiry |
IGFBP6-1902HCL | Recombinant Human IGFBP6 cell lysate | +Inquiry |
EDC4-529HCL | Recombinant Human EDC4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cbiM2 Products
Required fields are marked with *
My Review for All cbiM2 Products
Required fields are marked with *
0
Inquiry Basket