Recombinant Full Length Escherichia Coli Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL35544EF |
Product Overview : | Recombinant Full Length Escherichia coli Membrane protein insertase YidC(yidC) Protein (C4ZYY3) (1-548aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-548) |
Form : | Lyophilized powder |
AA Sequence : | MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQAQQTTQTTTTAAGSAADQGVPASGQGKL ISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGP DNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNV QNAGEKPLEISSFGQLKQSITLPPHLDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIAD NENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQT GAMNSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFVGNWGFSIII ITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDKQRISQEMMALYKAEKVNPL GGCFPLLIQMPIFLALYYMLMGSVELRQAPFALWIHDLSAQDPYYILPILMGVTMFFIQK MSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGL HSREKKKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; BWG_3396; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | C4ZYY3 |
◆ Recombinant Proteins | ||
BECN1-2370M | Recombinant Mouse BECN1 Protein | +Inquiry |
FRMD4B-6039M | Recombinant Mouse FRMD4B Protein | +Inquiry |
ALDH16A1-1609H | Recombinant Human ALDH16A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CACYBP-844H | Recombinant Human CACYBP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PEDINA-P06-4595S | Recombinant Staphylococcus aureus (strain: E-1) PEDINA_P06 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Heart-005H | Human Heart Lysate, Total Protein | +Inquiry |
THBS1-31514TH | Native Human THBS1 | +Inquiry |
Plg-5356M | Native Mouse Plg protein | +Inquiry |
ALB-128C | Native Canine Serum Albumin | +Inquiry |
Lectin-1849U | Active Native Ulex Europaeus Agglutinin I Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
POPDC3-3007HCL | Recombinant Human POPDC3 293 Cell Lysate | +Inquiry |
IL4I1-5225HCL | Recombinant Human IL4I1 293 Cell Lysate | +Inquiry |
C7orf25-7972HCL | Recombinant Human C7orf25 293 Cell Lysate | +Inquiry |
TMEM41B-951HCL | Recombinant Human TMEM41B 293 Cell Lysate | +Inquiry |
WNK1-1933HCL | Recombinant Human WNK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket