Recombinant Full Length Pasteurella Multocida Electron Transport Complex Protein Rnfa(Rnfa) Protein, His-Tagged
Cat.No. : | RFL16160PF |
Product Overview : | Recombinant Full Length Pasteurella multocida Electron transport complex protein RnfA(rnfA) Protein (Q9CNP0) (1-192aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pasteurella multocida |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-192) |
Form : | Lyophilized powder |
AA Sequence : | MTEYILLIISTALINNFVLVKFLGLCPFMGVSKKIETAIGMSLATMFVLTVASISAYLID TYILTPLSATFLRTLVFILVIAVVVQFTEMVINKTSPTLYRLLGIFLPLITTNCAVLGVA LLNINQAHTLTQSVIYGFGASLGFGLVLVLFAALRERLAAADVPHVFKGASIALITAGLM SLAFMGFTGLVR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PM0387 |
Synonyms | rnfA; PM0387; Ion-translocating oxidoreductase complex subunit A; Rnf electron transport complex subunit A |
UniProt ID | Q9CNP0 |
◆ Native Proteins | ||
CGA-8162H | Native Human Pregnancy Chorionic Gonadotropin | +Inquiry |
FSH-1564H | Active Native Human Follicle Stimulating Hormone | +Inquiry |
IgG-219H | Native Human Immunoglobulin G | +Inquiry |
Thrombin-28B | Active Native Bovine alpha-Thrombin-DFP | +Inquiry |
ACHE-8345H | Native Human ACHE | +Inquiry |
◆ Cell & Tissue Lysates | ||
Tonsil-535C | Cynomolgus monkey Tonsil Lysate | +Inquiry |
Liver-784D | Dog Liver Membrane Lysate, Total Protein | +Inquiry |
WFS1-316HCL | Recombinant Human WFS1 293 Cell Lysate | +Inquiry |
Intestine-767C | Chicken Intestine Membrane Lysate, Total Protein | +Inquiry |
CRISP1-400HCL | Recombinant Human CRISP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PM0387 Products
Required fields are marked with *
My Review for All PM0387 Products
Required fields are marked with *
0
Inquiry Basket