Recombinant Full Length Pasteurella Haemolytica Leukotoxin Translocation Atp-Binding Protein Lktb(Lktb) Protein, His-Tagged
Cat.No. : | RFL11936MF |
Product Overview : | Recombinant Full Length Pasteurella haemolytica Leukotoxin translocation ATP-binding protein LktB(lktB) Protein (Q93FH3) (1-708aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mannheimia Haemolytica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-708) |
Form : | Lyophilized powder |
AA Sequence : | MEANHQRNDLGLVALTMLAQYHNISLNPEEIKHKFDLDGKGLSLTSWLLAAKSLALKAKH IKKEISRLHLVNLPALVWQDNGKHFLLVKVDTDNNRYLTYNLEQDAPQILSQDEFEACYQ GQLILVTSRASVVGQLAKFDFTWFIPAVIKYRKIFLETLIVSIFLQIFALITPLFFQVVM DKVLVHRGFSTLNIITVALAIVIIFEIVLSGLRTYVFSHSTSRIDVELGAKLFRHLLSLP ISYFENRRVGDTVARVRELDQIRNFLTGQALTSVLDLLFSFIFFAVMWYYSPKLTLVILG SLPCYILWSIFISPILRRRLDDKFARSADNQAFLVESVTAINMIKAMAVAPQMTDTWDKQ LASYVSSSFRVTVLATIGQQGVQLIQKTVMVINLWLGAHLVISGDLSIGQLIAFNMLSGQ VIAPVIRLAQLWQDFQQVGISVTRLGDVLNSPTEQYQGKLSLPEIKGDISFKNIRFRYKP DAPTILNNVNLEIRQGEVIGIVGRSGSGKSTLTKLLQRFYIPENGQVLIDGHDLALADPN WLRRQIGVVLQDNVLLNRSIRENIALSDPGMPMERVIYAAKLAGAHDFISELREGYNTIV GEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYQSEHIIMQNMQKICQGRTVIL IAHRLSTVKNADRIIVMEKGEIVEQGKHHELLQNSNGLYSYLHQLQLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lktB |
Synonyms | lktB; Leukotoxin translocation ATP-binding protein LktB |
UniProt ID | Q93FH3 |
◆ Recombinant Proteins | ||
Cd47-7480RAF647 | Recombinant Rat Cd47 Protein, hFc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
SCG2-4908R | Recombinant Rat SCG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SAP029A-026-2005S | Recombinant Staphylococcus aureus (strain: WB43S, other: ST73-MRSA-IVa (2B)) SAP029A_026 protein, His-tagged | +Inquiry |
GTF2H5-55H | Recombinant Human GTF2H5 protein, His-tagged | +Inquiry |
Prss2-909M | Active Recombinant Mouse Prss2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Acta1-158M | Native Mouse skeletal muscle alpha Actin | +Inquiry |
Annexin-V-011H | Native Human Annexin-V Protein, FITC conjugated | +Inquiry |
Lectin-1853U | Active Native Ulex Europaeus Agglutinin I Protein, Fluorescein labeled | +Inquiry |
VWF-17H | Native Human von Willebrand Factor, Factor VIII Free | +Inquiry |
CDA016 | Native Hepatitis B Surface Ag protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSF-420HCL | Recombinant Human CTSF cell lysate | +Inquiry |
MS4A12-4128HCL | Recombinant Human MS4A12 293 Cell Lysate | +Inquiry |
MAPK13-574HCL | Recombinant Human MAPK13 cell lysate | +Inquiry |
IFNA8-1012HCL | Recombinant Human IFNA8 Overexpression Lysate(Met1-Glu189) | +Inquiry |
ZNF649-754HCL | Recombinant Human ZNF649 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lktB Products
Required fields are marked with *
My Review for All lktB Products
Required fields are marked with *
0
Inquiry Basket