Recombinant Full Length Paracoccus Denitrificans Protein Niri(Niri) Protein, His-Tagged
Cat.No. : | RFL10668PF |
Product Overview : | Recombinant Full Length Paracoccus denitrificans Protein NirI(nirI) Protein (Q51699) (31-681aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Paracoccus Denitrificans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (31-681) |
Form : | Lyophilized powder |
AA Sequence : | EPLAAPDAALAQALFGADGPVVLDRRETPVPGWGVSRDGRMLGVIGSTWEIAATTGYSGK PLDVLVAVTPQGVIAGARLVRQTEPVLSLGISEAHIAAYVDGFRGVDLSQGEGQGRALPD VISRATVSTGVIRDGILRSARVLAQAQGLGGGGIDRVGYRPATWADLLAEGAFGHALVSM ADAARAFAGAKVPVEPSDAPFLDLYAGLIDPPTVGRNLLGAQDFTAAAGALQPGQALVAV LSRGLYSPRGTEWRRSGRFERIAFEQGALRIEPDDGDFVMVEKLALPDAPAFKEISLFRL NIDPLAGGIDPRRPFDLVVTATRPLAAGDEAALPIRATIRLPEAYAVAEAPAVPLWQEFW LKKIPGIAVVAAMLFVLALILFGQEALVRRPMLWRRVRLGFLATTLVVLGWGLNGQLSVV QVVAFLNALLSGFRWETFLIEPIIFLIWSAVALGLLFWGRGVFCGWLCPFGALQELANAA AQRLGVRQIAVPQALHERLWVIKYTLFVAIVALSFYSMEQALILAEVEPFKTVISMRFLR AWPFVLFALAVLAGGLFIERFYCRYLCPLGAGLAIPAKLKIFDWLRRRPQCGRECRLCET KCTVGAIDPLGRINPNECVLCLRCQVVMNDPGTCPVLKRRARSAAPTGDAP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nirI |
Synonyms | nirI; Pden_2486; Protein NirI |
UniProt ID | Q51699 |
◆ Recombinant Proteins | ||
Acsm4-1511M | Recombinant Mouse Acsm4 Protein, Myc/DDK-tagged | +Inquiry |
Gsk3b-3318M | Recombinant Mouse Gsk3b Protein, Myc/DDK-tagged | +Inquiry |
PANK3-1521H | Recombinant Human PANK3, GST-tagged | +Inquiry |
PRSS1-5894H | Recombinant Human PRSS1 protein, Fc/His-tagged | +Inquiry |
ESYT1-1507R | Recombinant Rhesus monkey ESYT1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1795A | Active Native Artocarpus integrifolia Jacalin Protein | +Inquiry |
Lectin-1859W | Active Native Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
FGG -48S | Native Sheep Fibrinogen, FITC Labeled | +Inquiry |
WIM-5415B | Native Bovine Vimentin | +Inquiry |
CDA007 | Native Human Cancer Antigen 72-4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRF1-180HCL | Recombinant Human BRF1 cell lysate | +Inquiry |
RRNAD1-8147HCL | Recombinant Human C1orf66 293 Cell Lysate | +Inquiry |
CTNNB1-563HCL | Recombinant Human CTNNB1 cell lysate | +Inquiry |
HYPK-8260HCL | Recombinant Human C15orf63 293 Cell Lysate | +Inquiry |
CCT6A-173HCL | Recombinant Human CCT6A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All nirI Products
Required fields are marked with *
My Review for All nirI Products
Required fields are marked with *
0
Inquiry Basket