Recombinant Full Length Paracoccidioides Brasiliensis Probable Endonuclease Lcl3(Lcl3) Protein, His-Tagged
Cat.No. : | RFL3570PF |
Product Overview : | Recombinant Full Length Paracoccidioides brasiliensis Probable endonuclease LCL3(LCL3) Protein (C0SEQ8) (1-342aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Paracoccidioides brasiliensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-342) |
Form : | Lyophilized powder |
AA Sequence : | MRWLFWSSGSQQAPNSNKDNNNNNDGDDDNNNIIINNINRRPPLTLECPSPSHPPCASCS TKATTSPSNPKRGWNTSLTARDWAGEFKDPRNLIPTLLLTGGILFCVRIHRQYLRRIPLA TNISPTYFHKRSLFGRVTSVGDGDNFRMYHTPGGRLAGWEWLPFRRVPRVKKELKDRTIH IRLAGIDAPELPHFGRPAQPYSHAAHTWLTNYLLNKRVRAFPYRQDQYGRVVATVYVRRF PWIFLRRDVGLQMLRAGMATVYEAKSGVEFGGEGKESKYRRAEEMAKRRGRGLWKGWKGA GWESPREYKNRMAGVEGERAAAGGGGGGVGGMGELGVNGGKN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LCL3 |
Synonyms | LCL3; PABG_06163; Probable endonuclease LCL3 |
UniProt ID | C0SEQ8 |
◆ Native Proteins | ||
FSHB-672H | Native Human Follicle Stimulating Hormone, Beta Polypeptide | +Inquiry |
Spinal cord-C57M | Mouse Spinal cord whole Lysate, Total Protein | +Inquiry |
HbA1c-199H | Native Human Hemoglobin A1C | +Inquiry |
a-acid glycoprotein-003H | Native Human a-acid glycoprotein Protein | +Inquiry |
F2-276B | Active Native Bovine α-Thrombin-FPRck (FPR-CMK*) | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOBKL2B-4264HCL | Recombinant Human MOBKL2B 293 Cell Lysate | +Inquiry |
EMC3-1012HCL | Recombinant Human TMEM111 293 Cell Lysate | +Inquiry |
FAM38B-6381HCL | Recombinant Human FAM38B 293 Cell Lysate | +Inquiry |
IL17RC-494HCL | Recombinant Human IL17RC cell lysate | +Inquiry |
EIF5-6642HCL | Recombinant Human EIF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All LCL3 Products
Required fields are marked with *
My Review for All LCL3 Products
Required fields are marked with *
0
Inquiry Basket