Recombinant Full Length Parabacteroides Distasonis Upf0365 Protein Bdi_2116 (Bdi_2116) Protein, His-Tagged
Cat.No. : | RFL12643PF |
Product Overview : | Recombinant Full Length Parabacteroides distasonis UPF0365 protein BDI_2116 (BDI_2116) Protein (A6LDT3) (1-330aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Parabacteroides distasonis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-330) |
Form : | Lyophilized powder |
AA Sequence : | MEITFLPLILLGAAVLLLAIFFYYVPFLLWISAKVSGVNISLIQLFLMRIRKVPPYIITR AMIEAHKAGIKTLTRDELEAHYLAGGHVEKVVHALVSASKANIDLPFQMATAIDLAGRDV FEAVQMSVNPKVIDTPPVTAVAKDGIQLIAKARVTVRANIKQLVGGAGEETILARVGEGI VSSIGSSESHKTVLENPDSISKLVLRKGLDAGTAFEILSIDIADIDIGKNIGAFLQMDQA QADKNIAQAKAEERRAMAVALEQEMKAKAQEARAKVIEAEAEVPKAMADAFRTGNLGVMD YYKMKNIEADTSMREAIAKPTGAPSKPLKD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BDI_2116 |
Synonyms | floA; BDI_2116; Flotillin-like protein FloA |
UniProt ID | A6LDT3 |
◆ Native Proteins | ||
UMOD-91P | Native Porcine UMOD | +Inquiry |
Colon-009H | Human Colon Lysate, Total Protein | +Inquiry |
Lectin-1746M | Active Native Maackia Amurensis Lectin I Protein | +Inquiry |
IGHA1-210H | Native Human Immunoglobulin A1 (IgA1) | +Inquiry |
GH1-8147H | Native Growth Hormone (GH) | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFKBIL1-3847HCL | Recombinant Human NFKBIL1 293 Cell Lysate | +Inquiry |
RAB11FIP2-2629HCL | Recombinant Human RAB11FIP2 293 Cell Lysate | +Inquiry |
ULK4-1884HCL | Recombinant Human ULK4 cell lysate | +Inquiry |
CD1B & B2M-001HCL | Recombinant Human CD1B & B2M cell lysate | +Inquiry |
P4HA1-3483HCL | Recombinant Human P4HA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BDI_2116 Products
Required fields are marked with *
My Review for All BDI_2116 Products
Required fields are marked with *
0
Inquiry Basket