Recombinant Full Length Papio Anubis Sugar Transporter Sweet1(Slc50A1) Protein, His-Tagged
Cat.No. : | RFL12448PF |
Product Overview : | Recombinant Full Length Papio anubis Sugar transporter SWEET1(SLC50A1) Protein (Q95KW8) (1-221aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Papio anubis (Olive baboon) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-221) |
Form : | Lyophilized powder |
AA Sequence : | MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSY GALKGDRILIVVNTVGAALQTLYILAYLHYCPRKRVVLLQTATLLGVLLLGYGYFWLLVP NPEARLQLLGLFCSVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATVLTSASWCLYGF RLRVPYIMVSNFPGIVTSFIRFWLFWKYPQEQDRNYWFLQT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SLC50A1 |
Synonyms | SLC50A1; Sugar transporter SWEET1; Solute carrier family 50 member 1; Uterine stromal cell protein |
UniProt ID | Q95KW8 |
◆ Cell & Tissue Lysates | ||
SLC50A1-2548HCL | Recombinant Human RAG1AP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC50A1 Products
Required fields are marked with *
My Review for All SLC50A1 Products
Required fields are marked with *
0
Inquiry Basket