Recombinant Full Length Pan Troglodytes Olfactory Receptor 3A2(Or3A2) Protein, His-Tagged
Cat.No. : | RFL17172PF |
Product Overview : | Recombinant Full Length Pan troglodytes Olfactory receptor 3A2(OR3A2) Protein (Q9TU97) (1-315aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pan troglodytes |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-315) |
Form : | Lyophilized powder |
AA Sequence : | MEPEAGTNRTAVAEFILLGLVQTEEMQPVVFVLFLFAYLVTIGGNLSILAAILVEPKLHA PMYFFLGNLSVLDVGCITVTVPAMLGRLLSHKSTISYDACLSQLFFFHLLAGMDCFLLTA MAYDRFLAICWPLTYSTRMSQTVQRMLVAASWACAFTNALTHTVAMSTLNFCGPNEVNHF YCDLPQLFQLSCSSTQLNELLLFAVGFIMAGTPLVLIITSYSHVAAAVLRIRSVEGWKKA FSTCGSHLTVVCLFFGTGIFNYMRLGSEEASDKDKGVGVFNTVINPMLNPLIYSLRNPDV QGALWRIFLGRRSLT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OR3A2 |
Synonyms | OR3A2; Olfactory receptor 3A2 |
UniProt ID | Q9TU97 |
◆ Recombinant Proteins | ||
Fgfr3-1739M | Recombinant Mouse Fibroblast Growth Factor Receptor 3 | +Inquiry |
FSTL1-3456H | Recombinant Human FSTL1 Protein (Glu21-Ile308), C-His tagged | +Inquiry |
CD276-542HAF555 | Active Recombinant Human CD276 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
LYNX1-2424R | Recombinant Rhesus Macaque LYNX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
C5orf60-3906HF | Recombinant Full Length Human C5orf60 Protein | +Inquiry |
◆ Native Proteins | ||
A1AGP-01P | Native Porcine A1AGP Protein | +Inquiry |
CA19-9-01H | Active Native Human CA19-9 protein | +Inquiry |
C4-195H | Native Human Complement C4c | +Inquiry |
Tryptase-01H | Active Native Human Tryptase Protein | +Inquiry |
Lectin-1817P | Active Native Peanut Lectin Protein, Rhodamine labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL13RA2-896CCL | Recombinant Canine IL13RA2 cell lysate | +Inquiry |
KLHL32-923HCL | Recombinant Human KLHL32 cell lysate | +Inquiry |
MAB21L1-4573HCL | Recombinant Human MAB21L1 293 Cell Lysate | +Inquiry |
ARMC7-8700HCL | Recombinant Human ARMC7 293 Cell Lysate | +Inquiry |
Pancreas-364H | Human Pancreas Membrane Diabetic Disease Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All OR3A2 Products
Required fields are marked with *
My Review for All OR3A2 Products
Required fields are marked with *
0
Inquiry Basket