Recombinant Full Length Pan Troglodytes Cell Cycle Control Protein 50C(Tmem30C) Protein, His-Tagged
Cat.No. : | RFL20403PF |
Product Overview : | Recombinant Full Length Pan troglodytes Cell cycle control protein 50C(TMEM30C) Protein (A0ZT23) (1-157aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pan troglodytes |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-157) |
Form : | Lyophilized powder |
AA Sequence : | MEERAQHCLSRLLDNSALKQQELPIHRLYFTARRVLFVFFATGIFCLCMGIILILSARSTQEIEINYTRICANCAKLQENASNFDKECTCSIPFYLSGKMMGNVYMYYKLYGFYQNLYLYIRSRSNRQLVGKDVKVRLNLIWYNTLFLFLNQVDFSV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM30C |
Synonyms | TMEM30C; CDC50C; Cell cycle control protein 50C; Transmembrane protein 30C |
UniProt ID | A0ZT23 |
◆ Recombinant Proteins | ||
TMEM30C-17033M | Recombinant Mouse TMEM30C Protein | +Inquiry |
TMEM30C-9389M | Recombinant Mouse TMEM30C Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL20403PF | Recombinant Full Length Pan Troglodytes Cell Cycle Control Protein 50C(Tmem30C) Protein, His-Tagged | +Inquiry |
TMEM30C-10874Z | Recombinant Zebrafish TMEM30C | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM30C Products
Required fields are marked with *
My Review for All TMEM30C Products
Required fields are marked with *
0
Inquiry Basket