Recombinant Full Length Oryzias Latipes Probable G-Protein Coupled Receptor Protein, His-Tagged
Cat.No. : | RFL11799OF |
Product Overview : | Recombinant Full Length Oryzias latipes Probable G-protein coupled receptor Protein (Q91178) (1-428aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oryzias latipes |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-428) |
Form : | Lyophilized powder |
AA Sequence : | MMADKTSPMITSDHSISNFSTGLFGPHPTVPPDVGVVTSSQSQMKDLFGLFCMVTLNLIA LLANTGVMVAIARAPHLKKFAFVCHLCAVDVLCAILLMPLGIISSSPFFGTVVFTILECQ VYIFLNVFLIWLSILTITAISVERYFYIVHPMRYEVKMTINLVIGVMLLIWFKSLLLALV TLFGWPPYGHQSSIAASHCSLHASHSRLRGVFAVLFCVICFLAPVVVIFSVYSAVYKVAR SAALQQVPAVPTWADASPAKDRSDSINSQTTIITTRTLPQRLSPERAFSGGKAALTLAFI VGQFLVCWLPFFIFHLQMSLTGSMKSPGDLEEAVNWLAYSSFAVNPSFYGLLNRQIRDEL VKFRRCCVTQPVEIGPSSLEGSFQENFLQFIQRTSSSSETHPSFANSNPRNMENQAHKIP GQIPEEQA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Oryzias latipes Probable G-protein coupled receptor |
Synonyms | Probable G-protein coupled receptor; Fragment |
UniProt ID | Q91178 |
◆ Recombinant Proteins | ||
FGF1-8498H | Active Recombinant Human FGF1, His-tagged | +Inquiry |
PI4K2A-159H | Active Recombinant Human PI4K2A protein, GST-tagged | +Inquiry |
TENT5A-2173H | Recombinant Human TENT5A Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM199-6148R | Recombinant Rat TMEM199 Protein | +Inquiry |
PTPN13-463H | Recombinant Human PTPN13,GST-tagged,Active | +Inquiry |
◆ Native Proteins | ||
TNFRSF11B-54H | Native Human Osteoprotegerin | +Inquiry |
Hyaluronidase-39O | Active Native Ovine Hyaluronidase | +Inquiry |
C8-103H | Native Human C8 Protein | +Inquiry |
Urease-52J | Active Native Jack Bean Urease | +Inquiry |
GPT-26879TH | Native Human GPT | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDE1-5971HCL | Recombinant Human GDE1 293 Cell Lysate | +Inquiry |
FAM9A-6335HCL | Recombinant Human FAM9A 293 Cell Lysate | +Inquiry |
CD28-2002MCL | Recombinant Mouse CD28 cell lysate | +Inquiry |
CCNH-7705HCL | Recombinant Human CCNH 293 Cell Lysate | +Inquiry |
TIMM10-1073HCL | Recombinant Human TIMM10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Oryzias latipes Probable G-protein coupled receptor Products
Required fields are marked with *
My Review for All Oryzias latipes Probable G-protein coupled receptor Products
Required fields are marked with *
0
Inquiry Basket