Recombinant Full Length Oryza Sativa Subsp. Japonica Upf0603 Protein Os05G0401100, Chloroplastic(Os05G0401100, Loc_Os05G33280) Protein, His-Tagged

Cat.No. : RFL7585OF
Product Overview : Recombinant Full Length Oryza sativa subsp. japonica UPF0603 protein Os05g0401100, chloroplastic(Os05g0401100, LOC_Os05g33280) Protein (Q6ATY4) (99-299aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rice
Source : E.coli
Tag : His
Protein Length : Full Length of Mature Protein (99-299)
Form : Lyophilized powder
AA Sequence : SEFDVLNGGPPEDTYVVDDAGVLSRVTKSDVKRLVRDLESRKNIRINFITVRKLTSKADA FEYADQVLEKWYPTVEEGNNKGIVVLVTSQKEGAITGGPAFVQAVGDEILDSTVSENLPV LATDEKYNEAIYTTAKRLAAAIDGLPDPGGPTFKDNKRESNFKTKEETEEKRGQFTLVVG GLLVIAFVVPMAQYYAYISKK
Purity : Greater than 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Storage Buffer : Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name Os05g0401100
Synonyms Os05g0401100; LOC_Os05g33280; OSJNBa0035J16.9; UPF0603 protein Os05g0401100, chloroplastic
UniProt ID Q6ATY4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Os05g0401100 Products

Required fields are marked with *

My Review for All Os05g0401100 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon