Recombinant Full Length Oryza Sativa Subsp. Japonica Putative Magnesium Transporter Mrs2-H(Mrs2-H) Protein, His-Tagged
Cat.No. : | RFL24233OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Putative magnesium transporter MRS2-H(MRS2-H) Protein (Q10S25) (1-435aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-435) |
Form : | Lyophilized powder |
AA Sequence : | MALPCAFLSAAAAANATSFSSSPESRRCRSVHRVPSRPRPPLAPPARVMGKGNSKRKAAN TRLWMRLDRRGGCEMILCDKSFVARRSGLPARDLRVLSPLLSRSPSILAREKAMVINLEF VRAIVTADEVLVLEPLAQEVLPFVEKLRKHFPLKSLDVDDVSTHMHTENQDGELAQDVSC YEVEGANHELPFEFQVLDFALEAVCLSYNSTISDLNRSAIAVLDDLMKSVSTRNLERVWS LKSSLTRLLASVQKVRDEVEHILDDNEAMAHLCTARKTKGQKDLLNTILFPETRLCRTHS SIENSTGIRTCVPSDSDAHILDMLLEAYFKQLDGIRNRIFLVRQYIVDTEDYISIQLDNK RNELLGLQLTLIIASFGIAINTFIAAAFAMNIPHRGYHFVIGVPFGQFVGATSFLCMSIV ILLFTYAWRNRLLCT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MRS2-H |
Synonyms | MRS2-H; Os03g0137700; LOC_Os03g04480; OsJ_09331; Putative magnesium transporter MRS2-H |
UniProt ID | Q10S25 |
◆ Recombinant Proteins | ||
RFL23076PF | Recombinant Full Length Phaseolus Vulgaris Nad(P)H-Quinone Oxidoreductase Subunit 4L, Chloroplastic Protein, His-Tagged | +Inquiry |
CSDE1-2151HF | Recombinant Full Length Human CSDE1 Protein, GST-tagged | +Inquiry |
EPS15L1-12505H | Recombinant Human EPS15L1, GST-tagged | +Inquiry |
UCP1-9872M | Recombinant Mouse UCP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HTRA2-1144H | Recombinant Human HTRA2, His tagged | +Inquiry |
◆ Native Proteins | ||
HMGB1-8447B | Active Native Bovine HMGB1 | +Inquiry |
FGG -44D | Native Canine Fibrinogen, FITC Labeled | +Inquiry |
Lectin-1769D | Active Native Dolichos Biflorus Agglutinin Protein, Biotinylated | +Inquiry |
S100A1B-9H | Native Human S100A1B | +Inquiry |
Lecithin-09E | Native Egg Yolk Lecithin | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRF1-3699HCL | Recombinant Human NRF1 293 Cell Lysate | +Inquiry |
PTS-2668HCL | Recombinant Human PTS 293 Cell Lysate | +Inquiry |
ARMS2-8693HCL | Recombinant Human ARMS2 293 Cell Lysate | +Inquiry |
LRRC42-4629HCL | Recombinant Human LRRC42 293 Cell Lysate | +Inquiry |
MVP-4050HCL | Recombinant Human MVP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRS2-H Products
Required fields are marked with *
My Review for All MRS2-H Products
Required fields are marked with *
0
Inquiry Basket