Recombinant Full Length Oryza Sativa Subsp. Japonica Putative Magnesium Transporter Mrs2-G(Mrs2-G) Protein, His-Tagged
Cat.No. : | RFL18957OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Putative magnesium transporter MRS2-G(MRS2-G) Protein (A3BV82) (1-468aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-468) |
Form : | Lyophilized powder |
AA Sequence : | MGRRSGGRKLPFFASNASTSSSTKRTRSARRLPSLTRPRASSSPSPASPSPPPPSASHPA PPSPPLAVSPAGAGKVGKKKAGARLWMRLDRWGVSETLHLDKGSIIRRAGLPPRDLRILG PVFSDSSSILAREKAMVINLEFIRAIVTADEILLLDPLTIDVIPFVEQLTHHLPLKNLVC GNGQPGGDDHGEKHDDSHGDQVPRLNEATGAEHELPFEFQVLELALETVCSSFDVNVSGL ERRATPVLEELTKNVSTRNLDRVRTLKSDLTRLLAHVQKVRDEIEHLLDDNEDMAHLYLT RKQLQNQQVEALISSAASNSIVPGGTSLSRLNNSFRRSVSIATSMHLDNDVEDLEMLLEA YFMQLDGIRNRILSVREYIDDTEDYVNIQLDNQRNELIQLQLTLTIASFGIAVNTFIAGA FAMNIQSKLYSIDDGSFFWPFVGGTSSGCFMICIVLLWYARWKKLLGP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MRS2-G |
Synonyms | MRS2-G; Os10g0545000; LOC_Os10g39790; OsJ_28078; OSJNBa0001O14.11; Putative magnesium transporter MRS2-G |
UniProt ID | A3BV82 |
◆ Native Proteins | ||
R-PE-004R | Native Red Fluorescent Protein | +Inquiry |
RNASE2-171H | Native Human Eosinophil Derived Neurotoxin | +Inquiry |
Alpha Macroglobulin-86M | Native Mouse Alpha Macroglobulin | +Inquiry |
Rectum-024H | Human Rectum Lysate, Total Protein | +Inquiry |
Papain-149 | Active Native Immobilized Papain | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRKCDBP-2858HCL | Recombinant Human PRKCDBP 293 Cell Lysate | +Inquiry |
RNPC3-2261HCL | Recombinant Human RNPC3 293 Cell Lysate | +Inquiry |
Placenta-385R | Rat Placenta Lysate | +Inquiry |
ORMDL3-3546HCL | Recombinant Human ORMDL3 293 Cell Lysate | +Inquiry |
LCE3D-4806HCL | Recombinant Human LCE3D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRS2-G Products
Required fields are marked with *
My Review for All MRS2-G Products
Required fields are marked with *
0
Inquiry Basket