Recombinant Full Length Oryza Sativa Subsp. Japonica Putative Ammonium Transporter 4 Member 1(Amt4-1) Protein, His-Tagged

• Cat.No.: RFL14141OF
• Product Overview: Recombinant Full Length Oryza sativa subsp. japonica Putative ammonium transporter 4 member 1(AMT4-1) Protein (Q10CV4) (1-299aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Rice
• Source: E.coli
• Tag: His
• ProteinLength: Full Length (1-299)
• Form: Lyophilized powder
• AA Sequence: MAAEAAPEWVEKGDNAWPLAAATLVGLQSVPRLVILYGDCGAVGPRTEKDREAFPPNNVL LTLAGAGLLLWMGWTGFNGGAPYAANVDASVTVVNTHLCTATSLLVWLLLDSFVFGRLSV ISAVQGMITGLVCVTPAARLVLHKRSRLLARVDDTLAVLHTHGVAGSLSGVLTGLLLLAE PRFARLFFGDDPRYVGLAYAVRDGRAGSGLRQVGVQLAGIAFVVALNVAVTSAVCLAVRV AVPQLAGGGDAIHGEDAYAVWGDGETYEQYSVHGGGSNHGGFPMTANPVASKADEMIWI
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: AMT4-1
• Synonyms: AMT4-1; Os03g0749000; Os03g0749050; LOC_Os03g53780; OSJNBa0069E14.17; Putative ammonium transporter 4 member 1; OsAMT4;1
• UniProt ID: Q10CV4