Recombinant Full Length Oryza Sativa Subsp. Japonica Protein Disulfide Isomerase-Like 5-2(Pdil5-2) Protein, His-Tagged
Cat.No. : | RFL307OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Protein disulfide isomerase-like 5-2(PDIL5-2) Protein (Q0JD42) (36-423aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (36-423) |
Form : | Lyophilized powder |
AA Sequence : | EEFPRDGRVIELDESSFEAALGAIDYLFVDFYAPWCGHCKRLAPELDEAAPVLAGLSEPI IVAKVNADKYRKLGSKYGVDGFPTLMLFIHGVPIEYTGSRKADLLVRNLNKFVAPDVSIL ESDSAIKSFVENAGTSFPMFIGFGVNESLIAGYGGKYKKRAWFAVAKDFSEDFMVTYDFD KVPALVSLHPKYKEQSVFYGPFEGSFLEDFIRQSLLPLTVPINTETLKMLDDDDRKVVLA ILEDDSDETSSQLVKVLRSAANANRDLVFGYVGIKQWDEFVETFDISKSSQLPKLIVWDR NEEYEVVEGSEKLEEGDQASQISQFLEGYRAGRTTKKKVSGPSFMGFLNSLVSLNSLYIL ICVFALLGVMIYFTGQDDTPQVRRAHEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PDIL5-2 |
Synonyms | PDIL5-2; PDIL7-1; Os04g0432500; LOC_Os04g35290; OSJNBa0084A10.17; Protein disulfide isomerase-like 5-2; OsPDIL5-2; Protein disulfide isomerase-like 7-1; OsPDIL7-1 |
UniProt ID | Q0JD42 |
◆ Native Proteins | ||
HRP-002 | HRP, Rhodamine labeled | +Inquiry |
Hb-901M | Native Mouse Hemoglobin Protein | +Inquiry |
Lectin-1717U | Native Ulex europaeus Lectin | +Inquiry |
vip3A-38B | Native Bacillus thuringiensis vip3A Protein | +Inquiry |
C3-01R | Native Rabbit C3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAL3ST1-6046HCL | Recombinant Human GAL3ST1 293 Cell Lysate | +Inquiry |
NFAM1-3860HCL | Recombinant Human NFAM1 293 Cell Lysate | +Inquiry |
MXD4-1157HCL | Recombinant Human MXD4 cell lysate | +Inquiry |
PUS1-2663HCL | Recombinant Human PUS1 293 Cell Lysate | +Inquiry |
WASF1-368HCL | Recombinant Human WASF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDIL5-2 Products
Required fields are marked with *
My Review for All PDIL5-2 Products
Required fields are marked with *
0
Inquiry Basket