Recombinant Full Length Oryza Sativa Subsp. Japonica Probable Protein Phosphatase 2C 32(Os03G0292100, Loc_Os03G18150) Protein, His-Tagged
Cat.No. : | RFL34707OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Probable protein phosphatase 2C 32(Os03g0292100, LOC_Os03g18150) Protein (Q10MX1) (1-391aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-391) |
Form : | Lyophilized powder |
AA Sequence : | MSCTVAIPSSPVFSPSRRPLSCKAASASASPESVSVAASSPAQAAPPAGSPLRPFALRAH LREEATPSPQPSAAAAAAVSAPAGSVLKRRRPAPLVVPVCGGAAAAAAAAAVAAVESDPR NEVEEDGEEFAVYCRRGKGRRRVEMEDRHVAKVALGGDPKVAFFGVFDGHGGKSAAEFVA ENMPKFMAEEMCKVDGGDSGETEQAVKRCYLKTDEEFLKREESGGACCVTALLQKGGLVV SNAGDCRAVLSRAGKAEALTSDHRASREDERERIENLGGFVVNYRGTWRVQGSLAVSRGI GDAHLKQWVVSDPDTTTLGVDSQCEFLILASDGLWDKVENQEAVDIARPLYISNDKASRM TACRRLVETAVTRGSTDDISIVIIQLQQFSR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Os03g0292100 |
Synonyms | Os03g0292100; LOC_Os03g18150; Probable protein phosphatase 2C 32; OsPP2C32 |
UniProt ID | Q10MX1 |
◆ Recombinant Proteins | ||
TMPRSS5-4222H | Recombinant Human TMPRSS5 Protein, His (Fc)-Avi-tagged | +Inquiry |
MTMR7-5790M | Recombinant Mouse MTMR7 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCL8-034H | Recombinant Human CXCL8 Protein | +Inquiry |
RFL24058GF | Recombinant Full Length Gossypium Barbadense Photosystem Ii Reaction Center Protein H(Psbh) Protein, His-Tagged | +Inquiry |
CLPP-11343H | Recombinant Human CLPP, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ALB-115C | Native Chicken Serum Albumin | +Inquiry |
Lectin-1737W | Active Native Wheat Germ Agglutinin Protein, Peroxidase conjugated | +Inquiry |
HB-45R | Native Simian Hemoglobin (HB) Protein | +Inquiry |
COL4A1-001H | Native Human COL4A1 Protein | +Inquiry |
Lectin-1790G | Active Native Griffonia Simplicifolia Lectin II Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAPZA2-7852HCL | Recombinant Human CAPZA2 293 Cell Lysate | +Inquiry |
ABTB2-9120HCL | Recombinant Human ABTB2 293 Cell Lysate | +Inquiry |
RABGGTB-2572HCL | Recombinant Human RABGGTB 293 Cell Lysate | +Inquiry |
TTC31-1855HCL | Recombinant Human TTC31 cell lysate | +Inquiry |
CCNJL-7702HCL | Recombinant Human CCNJL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Os03g0292100 Products
Required fields are marked with *
My Review for All Os03g0292100 Products
Required fields are marked with *
0
Inquiry Basket