Recombinant Full Length Oryza Sativa Subsp. Japonica Probable Mannan Synthase 2(Csla2) Protein, His-Tagged
Cat.No. : | RFL5059OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Probable mannan synthase 2(CSLA2) Protein (Q7PC67) (1-580aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-580) |
Form : | Lyophilized powder |
AA Sequence : | MSTNGGAPSQKRSWLPSRPLLTTTTQTYPPPLLPFKKLHAPPTAARRSLPPAASKPMASS SSSSLPAAWAAAVRAWAVAPALRAAVWACLAMSAMLVAEAAWMGLASLAAAAARRLRGYG YRWEPMAAPPDVEAPAPAPAEFPMVLVQIPMYNEKEVYKLSIGAACALTWPPDRIIIQVL DDSTDPFVKELVELECKEWASKKINIKYEVRNNRKGYKAGALRKGMEHTYAQLCDFVAIF DADFEPESDFLLKTMPYLLHNPKIALVQTRWEFVNYNVCLMTRIQKMSLDYHFKVEQESG SFMHAFFGFNGTAGVWRVSAINQSGGWKDRTTVEDMDLAVRASLKGWEFLYVGDIRVKSE LPSTFQAYRHQQHRWTCGAANLFRKMAWEIITNKEVSMWKKYHLLYSFFFVRRAIAPILT FLFYCIVIPLSAMVPEVTIPVWGLVYIPTAITIMNAIRNPGSVHLMPFWILFENVMAMHR MRAALSGLLETARANDWVVTEKVGDQVKDELDVPLLEPLKPTECAERIYIPELLLALYLL ICASYDFVLGNHKYYIYIYLQAVAFTVMGFGFVGTRTPCS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CSLA2 |
Synonyms | CSLA2; Os10g0406400; LOC_Os10g26630; OSJNBa0060A14.12; Probable glucomannan 4-beta-mannosyltransferase 2; Cellulose synthase-like protein A2; OsCslA2; Glucomannan synthase; Mannan synthase 2 |
UniProt ID | Q7PC67 |
◆ Recombinant Proteins | ||
MUS81-5757H | Recombinant Human MUS81 Protein, GST-tagged | +Inquiry |
MPDZ-4578C | Recombinant Chicken MPDZ | +Inquiry |
RFL33569MF | Recombinant Full Length Mouse G-Protein Coupled Receptor Family C Group 5 Member B(Gprc5B) Protein, His-Tagged | +Inquiry |
ERO1L-1321R | Recombinant Rhesus Macaque ERO1L Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC105-1168R | Recombinant Rat CCDC105 Protein | +Inquiry |
◆ Native Proteins | ||
PTI-603B | Native Bovine Pancreatic Trypsin Inhibitor | +Inquiry |
GALM-40P | Active Native Porcine Mutarotase | +Inquiry |
MMP2-46H | Native Human MMP-2 | +Inquiry |
Lectin-1763A | Active Native Agaricus bisporus lectin Protein, Agarose bound | +Inquiry |
AFP-1180H | Native Human Alpha-Fetoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Jejunum-674H | Hamster Jejunum Lysate, Total Protein | +Inquiry |
PDS5A-1565HCL | Recombinant Human PDS5A cell lysate | +Inquiry |
MGLL-4330HCL | Recombinant Human MGLL 293 Cell Lysate | +Inquiry |
ART5-8671HCL | Recombinant Human ART5 293 Cell Lysate | +Inquiry |
DDI2-220HCL | Recombinant Human DDI2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSLA2 Products
Required fields are marked with *
My Review for All CSLA2 Products
Required fields are marked with *
0
Inquiry Basket