Recombinant Full Length Oryza Sativa Subsp. Japonica Probable Isoprenylcysteine Alpha-Carbonyl Methylesterase Icme(Imce) Protein, His-Tagged
Cat.No. : | RFL32409OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Probable isoprenylcysteine alpha-carbonyl methylesterase ICME(IMCE) Protein (Q6L5F5) (1-414aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-414) |
Form : | Lyophilized powder |
AA Sequence : | MQPASPVSGDAGPVAEAVPPRGAPQVLVRRRSVPFSPDSPLAPGSRGGGERRSTFREDVS HAAAETYLVTRLAFILLRYLGVGYRWISQLAALIIYAILLMPGFIRVGYYYFFSRQVLRS VIYGDQPRNRLDLYIPRDPKKPSPVVAFVTGGAWIIGYKAWGALLGRRLAERGIIVACID YRNFPQGTISDMVSDASDGISFVCETVGAYGGDPNQIYLMGQSAGAHIAACALLEQAAKE SRGEQISWSVTQIKAYFGLSGGYNIENLVDHFHERGLYRSIFLSIMEGKKSLPHFSPETV AKKLCPETIALLPQIVLLHGTDDYSIPFSASETFAGVLKQAGAKAKLLLYEGKTHTDVFL QDPLRGGRDKLVEDVISVIHADDADAREKDALAPIPGRLVSEWQIKLAHRISPF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | IMCE |
Synonyms | IMCE; Os05g0577200; LOC_Os05g50170; OJ1126_B10.7; Probable isoprenylcysteine alpha-carbonyl methylesterase ICME |
UniProt ID | Q6L5F5 |
◆ Recombinant Proteins | ||
ARHGAP27-1866M | Recombinant Mouse ARHGAP27 Protein | +Inquiry |
FOLR3-622H | Active Recombinant Human FOLR3, His-tagged | +Inquiry |
CNR1-27H | Recombinant Human CNR1 Full Length Transmembrane protein(VLPs) | +Inquiry |
ATP5C1-978H | Recombinant Human ATP5C1 protein, GST-tagged | +Inquiry |
TENM3-8604Z | Recombinant Zebrafish TENM3 | +Inquiry |
◆ Native Proteins | ||
Lectin-1865W | Active Native Succinylated Wheat Germ Agglutinin Protein, Biotinylated | +Inquiry |
FGB-35D | Native Canine Fibrinogen | +Inquiry |
Lectin-1747L | Active Native Lotus Tetragonolobus Lectin Protein | +Inquiry |
SULF2-02F | Active Native Flavobacterium heparinum 2-O-Sulfatase | +Inquiry |
Troponin I-11H | Native Human Troponin I protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRPM8-737HCL | Recombinant Human TRPM8 293 Cell Lysate | +Inquiry |
CSNK1D-7241HCL | Recombinant Human CSNK1D 293 Cell Lysate | +Inquiry |
MAPK14-001HCL | Recombinant Human MAPK14 cell lysate | +Inquiry |
MARVELD3-1063HCL | Recombinant Human MARVELD3 cell lysate | +Inquiry |
SENP2-583HCL | Recombinant Human SENP2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IMCE Products
Required fields are marked with *
My Review for All IMCE Products
Required fields are marked with *
0
Inquiry Basket