Recombinant Full Length Oryza Sativa Subsp. Japonica Probable Chlorophyll(Ide) B Reductase Nyc1, Chloroplastic(Nyc1) Protein, His-Tagged
Cat.No. : | RFL22762OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Probable chlorophyll(ide) b reductase NYC1, chloroplastic(NYC1) Protein (Q5N800) (34-504aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (34-504) |
Form : | Lyophilized powder |
AA Sequence : | CRAFKQEADNGGEEASSSPPPPTTAEARRRRKGPLYKLKAAIQGLAGSRSAAAEAYGGEY QRAVEKAEEIFFSVATQVGRYVITMMSSGVVLGVGFQLSGGDSQMNTLIWYSWLGGVIIG TMIGANSVLEEHCKAGPRNVVITGSTRGLGKALAREFLLSGDRVVIASRSPESVLQTINE LEENIQEGLSVAKKKQREILLHAKVVGTSCDVCKPEDVKKLVNFAKDELGSIDIWINNAG TNKGFRPLVNFSDEDISQIVSTNLVGSLLCTREAMNVMQHQQKGGHVFNMDGAGSGGSST PLTAVYGSTKCGLRQFQASLLKESRRSKVGVHTASPGMVLTDLLLSGSSLRNKQMFNLIC ELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTAWVRRGRWFDEEGRAVYAAEAD RIRNWAESRARFSFTDAMEMYTENTWVSVFSLSVVCAFIILSSSGGPLPGT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NYC1 |
Synonyms | NYC1; Os01g0227100; LOC_Os01g12710; OsJ_00960; P0443E07.35; P0452F10.6; Probable chlorophyll(ide b reductase NYC1, chloroplastic; Protein NON-YELLOW COLORING 1; OsNYC1 |
UniProt ID | Q5N800 |
◆ Native Proteins | ||
Collagen Type I & III-06M | Native Mouse Collagen Type I and III Protein | +Inquiry |
Factor Xa-64H | Native Human Factor Xa | +Inquiry |
PLC-30 | Active Native Phospholipase C | +Inquiry |
ORM1-8013H | Native Human Serum Alpha-1-Acid GlycoProtein | +Inquiry |
IgG-253R | Native Rabbit IgG Protein, Tag Free, Agarose Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
C20orf79-8108HCL | Recombinant Human C20orf79 293 Cell Lysate | +Inquiry |
LRPAP1-2168MCL | Recombinant Mouse LRPAP1 cell lysate | +Inquiry |
DOLK-6842HCL | Recombinant Human DOLK 293 Cell Lysate | +Inquiry |
RAB34-2605HCL | Recombinant Human RAB34 293 Cell Lysate | +Inquiry |
GHDC-5943HCL | Recombinant Human GHDC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NYC1 Products
Required fields are marked with *
My Review for All NYC1 Products
Required fields are marked with *
0
Inquiry Basket