Recombinant Full Length Oryza Sativa Subsp. Japonica Magnesium Transporter Mrs2-I(Mrs2-I) Protein, His-Tagged
Cat.No. : | RFL27544OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Magnesium transporter MRS2-I(MRS2-I) Protein (Q10D38) (1-384aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-384) |
Form : | Lyophilized powder |
AA Sequence : | MAAAVVVAGEAAAAAAAAGAGGKKRGASRSWILFDAAGEERVLDADKYAIMHRVDINARD LRILDPLLSYPSTILGRERAIVLNLEHIKAIITAEEVLLRDPLDDNVIPVVEELRRRLAP SSATQHDVEGAEEDESPFEFRALEVTLEAICSFLGARTTELESAAYPALDELTSKISSRN LDRVRKLKSGMTRLNARVQKVRDELEQLLDDDDDMADLYLSRKLAGAASPVSGSGGPNWF PASPTIGSKISRASRASAPTIHGNENDVEELEMLLEAYFMQIDGTLNKLTTLREYIDDTE DYINIQLDNHRNQLIQLELFLSSGTVCLSLYSLVAGIFGMNIPYTWNDNHGYVFKWVVLV SGLFCAFMFVSIVAYARHKGLVGS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MRS2-I |
Synonyms | MRS2-I; Os03g0742400; LOC_Os03g53110; OJ1365_D05.9; OsJ_12521; Magnesium transporter MRS2-I |
UniProt ID | Q10D38 |
◆ Native Proteins | ||
C. abortus-35 | Native Chlamydia abortus Antigen | +Inquiry |
Lectin-1740A | Active Native Aleuria Aurantia Lectin Protein | +Inquiry |
Avidin-015 | Native Avidin Protein, Peroxidase conjugated | +Inquiry |
Complement C1s-44H | Native Human Complement C1s | +Inquiry |
Thermolysin | Native Geobacillus stearothermophilus Thermolysin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC35E4-1729HCL | Recombinant Human SLC35E4 293 Cell Lysate | +Inquiry |
MSR1-2288MCL | Recombinant Mouse MSR1 cell lysate | +Inquiry |
LRRC42-4629HCL | Recombinant Human LRRC42 293 Cell Lysate | +Inquiry |
DHRS7B-6935HCL | Recombinant Human DHRS7B 293 Cell Lysate | +Inquiry |
IFNA8-1012HCL | Recombinant Human IFNA8 Overexpression Lysate(Met1-Glu189) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MRS2-I Products
Required fields are marked with *
My Review for All MRS2-I Products
Required fields are marked with *
0
Inquiry Basket