Recombinant Full Length Oryza Sativa Subsp. Japonica Magnesium Transporter Mrs2-F(Mrs2-F) Protein, His-Tagged
Cat.No. : | RFL34234OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Magnesium transporter MRS2-F(MRS2-F) Protein (Q8L4S2) (1-444aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-444) |
Form : | Lyophilized powder |
AA Sequence : | MRPSAAAGGGGGGGGRRKAAAAAAAASREWLVVPASGQARVEEAGKHAVMARTGLPARDL RVLDPLLSYPSTILGRERAIVVNLERVKAVITAAEVLLPNSKDPAFASFVCDLQARVLAS SSDQAAEFTDMEGESSAVTSPFPALTSTTPNELEMTNKNSNVVGGMTHSNSMPTLTAAKD GNTKVLPFEFRALEVCLESACRSLEEETSTLEQEAYPALDELTSKISTLNLERVRQIKSR LVAISGRVQKVRDELEHLLDDEMDMAEMYLTEKLTRQEISETSSRVEVDDPSQLEVDRDE DYRSEADVSNGTFIGYKPHIEELEMLLEAYFVQIDGTLNKLSHLREYVDDTEDYINIMLD DKQNQLLQMGVMLSTATVVITAGVAVVGLFGMNIGISLYADPTNEEEKRASNMKFWETTL GTIAGCTVMYIVAMGWGKRSGLLQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MRS2-F |
Synonyms | MRS2-F; Os01g0908500; LOC_Os01g68040; B1417F08.35; OsJ_04478; P0456E05.8; P0497A05.17; Magnesium transporter MRS2-F |
UniProt ID | Q8L4S2 |
◆ Recombinant Proteins | ||
PKN2-1236H | Recombinant Human PKN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SGD-2 ftsH-1556b | Recombinant Bacterium SGD-2 ftsH Protein (Met1-Val633), C-His tagged | +Inquiry |
GOPC-10837Z | Recombinant Zebrafish GOPC | +Inquiry |
CXCL9-88O | Recombinant Ovine CXCL9 | +Inquiry |
RFL31566AF | Recombinant Full Length Arabidopsis Thaliana Oleosin 14.9 Kda(Ol3) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
VZV-05 | Native Varicella Zoster Virus (VZV) Glycoprotein Antigen | +Inquiry |
THBS1-31515TH | Native Human THBS1 | +Inquiry |
Lectin-1817P | Active Native Peanut Lectin Protein, Rhodamine labeled | +Inquiry |
Lectin-1858V | Active Native Vicia Villosa Lectin Protein | +Inquiry |
H3N2-01I | Active Native IAV H3N2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
H2AFV-5661HCL | Recombinant Human H2AFV 293 Cell Lysate | +Inquiry |
ELSPBP1-6614HCL | Recombinant Human ELSPBP1 293 Cell Lysate | +Inquiry |
HA-1751HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
TLK2-554HCL | Recombinant Human TLK2 cell lysate | +Inquiry |
DYNLL1-6758HCL | Recombinant Human DYNLL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRS2-F Products
Required fields are marked with *
My Review for All MRS2-F Products
Required fields are marked with *
0
Inquiry Basket