Recombinant Full Length Oryza Sativa Subsp. Japonica Magnesium Transporter Mrs2-C(Mrs2-C) Protein, His-Tagged
Cat.No. : | RFL21216OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica Magnesium transporter MRS2-C(MRS2-C) Protein (Q0JBZ6) (1-428aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-428) |
Form : | Lyophilized powder |
AA Sequence : | MDHDPKERLLLPPRAAAAAAANGPHRRAAPAAGGGGGGVAIDVHGLKRRGGGRRSWVRVD AATGASEAVEVAKPALMRRLDLPARDLRLLDPLFVYPSAILGRERAVVCNLERIRCIITA DEALILRDPDVAGGGAETEEAVRRYVAELQRRLVDRADDLPFEFIALEVALEAACSFLDA QAVELEADAYPLLDELTTKISTLNLERVRRLKSKLVALTRRVQKVRDEIEQLMDDDGDMA EMYLTEKKRRMEASLLEEQAFQGMGNSGFGSSFSAPVSPVSSPPASRRLEKELSFARSRH DSFKSADSSQYSIEELEMLLEAYFVVIDYTLSKLTSLKEYIDDTEDFINIQLDNVRNQLI QFELLLTTATFVVAIFGVVSGVFGMNFEVDLFNVPHAFEWTLVITGVCGLVIFCCFIWYF KKRRFFPL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MRS2-C |
Synonyms | MRS2-C; Os04g0501100; LOC_Os04g42280; OSJNBa0029H02.22; Magnesium transporter MRS2-C |
UniProt ID | Q0JBZ6 |
◆ Recombinant Proteins | ||
RFL4468SF | Recombinant Full Length Saccharomyces Cerevisiae Monopolar Spindle Protein 2(Mps2) Protein, His-Tagged | +Inquiry |
SNX17-2858H | Recombinant Human SNX17, GST-tagged | +Inquiry |
PDYN-31089TH | Recombinant Human PDYN | +Inquiry |
CCDC36-2873H | Recombinant Human CCDC36 Protein, His-tagged | +Inquiry |
PHF7-3483H | Recombinant Human PHF7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
GPT-188S | Active Native Swine Glutamate Pyruvate Transaminase | +Inquiry |
dsbA-8328E | Native E.coli dsbA | +Inquiry |
IgG-348G | Native Hamster Gamma Globulin Fraction | +Inquiry |
IgG-334D | Native Donkey IgG | +Inquiry |
C3-01R | Native Rabbit C3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLK6-1559HCL | Recombinant Human KLK6 cell lysate | +Inquiry |
LILRB2-1059HCL | Recombinant Human LILRB2 cell lysate | +Inquiry |
ZBTB5-212HCL | Recombinant Human ZBTB5 293 Cell Lysate | +Inquiry |
ITFG1-5140HCL | Recombinant Human ITFG1 293 Cell Lysate | +Inquiry |
IFNW1-1382HCL | Recombinant Human IFNW1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MRS2-C Products
Required fields are marked with *
My Review for All MRS2-C Products
Required fields are marked with *
0
Inquiry Basket