Recombinant Full Length Oryza Sativa Subsp. Japonica L-Galactono-1,4-Lactone Dehydrogenase 2, Mitochondrial(Gldh2) Protein, His-Tagged
Cat.No. : | RFL36166OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica L-galactono-1,4-lactone dehydrogenase 2, mitochondrial(GLDH2) Protein (Q2QXY1) (79-583aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (79-583) |
Form : | Lyophilized powder |
AA Sequence : | YAPLPDDLHAVSNWSATHEVHTRVLLQPDSLPVLHDALAAAHGERRKLRPLGSGLSPNGL ALSRAGMVNLALMDKVLDVDAKKKTVTVQAGIRVAELVDTLREHGLTLQNFASIREQQVG GIIQVGAHGTGARLPPIDEQVISMKLVTPAKGTIELSREKDPDLFYLARCGLGGLGVVAE VTLQCVERHQLIEHTFVSSADEVKKNHKKWLSENKHIKYLWIPYTDTVVVVQCNPPSRWR TPKFTSKYGKDEAIQHVRDLYRESLKKYRTKAESNDPEVDQLSFTELRDRLLALDPLDKD HVIRINKAEAEYWKKSEGYRMGWSDEILGFDCGGQQWVSETCFPAGTLAKPNMKDLDYIE ELLQLIEKEDIPAPAPIEQRWTACSRSPMSPASSSQEDDIFSWVGIIMYLPTSDARQRKE ITEEFFNYRSKTQTNLWDGYSAYEHWAKIEVPKDKDELTELLARLRKRFPVDAYNKARME LDPNKVLSNAKLEKLFPVTEVQHVK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GLDH2 |
Synonyms | GLDH2; Os12g0139600; LOC_Os12g04520; OsJ_35179; L-galactono-1,4-lactone dehydrogenase 2, mitochondrial |
UniProt ID | Q2QXY1 |
◆ Recombinant Proteins | ||
FAM83F-3100M | Recombinant Mouse FAM83F Protein, His (Fc)-Avi-tagged | +Inquiry |
YXBD-2299B | Recombinant Bacillus subtilis YXBD protein, His-tagged | +Inquiry |
CNTN1-2834H | Recombinant Human CNTN1 protein(241-600 aa), C-His-tagged | +Inquiry |
HSD17B1-7871M | Recombinant Mouse HSD17B1 Protein | +Inquiry |
ST3GAL4-4499R | Recombinant Rhesus monkey ST3GAL4 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
SERPINA3-5331H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 3 | +Inquiry |
IgG-341D | Native Dog IgG | +Inquiry |
TG-393H | Native Human Thyroglobulin | +Inquiry |
Fibrinogen-01S | Native Atlantic salmon Fibrinogen | +Inquiry |
VTN -33B | Native Bovine multimeric vitronectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
RETNLB-2416HCL | Recombinant Human RETNLB 293 Cell Lysate | +Inquiry |
Skin-774C | Chicken Skin Membrane Lysate, Total Protein | +Inquiry |
ADAM30-9035HCL | Recombinant Human ADAM30 293 Cell Lysate | +Inquiry |
SLC14A1-1803HCL | Recombinant Human SLC14A1 293 Cell Lysate | +Inquiry |
MAB21L2-4572HCL | Recombinant Human MAB21L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLDH2 Products
Required fields are marked with *
My Review for All GLDH2 Products
Required fields are marked with *
0
Inquiry Basket