Recombinant Full Length Oryza Sativa Subsp. Japonica Cobra-Like Protein 2(Bc1L2) Protein, His-Tagged
Cat.No. : | RFL10408OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica COBRA-like protein 2(BC1L2) Protein (Q75IW1) (30-458aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (30-458) |
Form : | Lyophilized powder |
AA Sequence : | YDPLDPNGNITIKWDITQWTPDGYVAVVTIYNFQKYRHIQAPGWSLGWAWAKKEIIWSMA GGQATEQGDCSAFKANIPHCCKRDPRVVDLVPGAPYNMQFGNCCKGGVLTSWVQDPLNAV ASFQITVGHSGTSNKTVKAPKNFTLKAPGPGYSCGLAQEVKPPTRFISLDGRRTTQAHVT WNVTCTYSQFVAQRAPTCCVSLSSFYNETIVNCPKCACGCQNKKPGSCVEGNSPYLASVV NGPGKGSLTPLVQCTPHMCPIRVHWHVKLNYRDYWRVKVTITNWNYRMNYSQWNLVVQHP NFENVSTVFSFNYKSLNPYGVINDTAMMWGVKYYNDLLMVAGPDGNVQSELLFRKDRSTF TFDKGWAFPRRIYFNGESCVMPSPDLYPWLPPSSTPRFRTVFLLMSFLVCGTLAFLHNHL VLDKNCGKC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BC1L2 |
Synonyms | BC1L2; Os03g0416300; LOC_Os03g30260; OsJ_11271; OSJNBb0059G13.19; COBRA-like protein 2; Protein BRITTLE CULM1-like 2 |
UniProt ID | Q75IW1 |
◆ Recombinant Proteins | ||
Nvl-4561M | Recombinant Mouse Nvl Protein, Myc/DDK-tagged | +Inquiry |
CA2-2060HFL | Recombinant Full Length Human CA2 Protein, C-Flag-tagged | +Inquiry |
GRK5-26369TH | Recombinant Human GRK5 | +Inquiry |
RFL10801RF | Recombinant Full Length Rat T-Cell Surface Glycoprotein Cd8 Beta Chain(Cd8B) Protein, His-Tagged | +Inquiry |
EPAS1-2115R | Recombinant Rat EPAS1 Protein | +Inquiry |
◆ Native Proteins | ||
SAP-96H | Native Human Serum amyloid P | +Inquiry |
PLAU-22H | Native Human PLAU protein | +Inquiry |
A1m-367M | Native Mouse A1m | +Inquiry |
GlycoProtein G-11H | Native HSV-2 GlycoProtein G | +Inquiry |
FABP3-10R | Native Rat FABP3 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RSPO1-001MCL | Recombinant Mouse RSPO1 cell lysate | +Inquiry |
CDH13-802RCL | Recombinant Rat CDH13 cell lysate | +Inquiry |
CLSTN2-7430HCL | Recombinant Human CLSTN2 293 Cell Lysate | +Inquiry |
ARHGDIB-8735HCL | Recombinant Human ARHGDIB 293 Cell Lysate | +Inquiry |
Pancreas-648B | Bovine Pancreas Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All BC1L2 Products
Required fields are marked with *
My Review for All BC1L2 Products
Required fields are marked with *
0
Inquiry Basket