Recombinant Full Length Oryza Sativa Subsp. Japonica Casp-Like Protein Ble3(Ble3) Protein, His-Tagged

• Cat.No.: RFL23261OF
• Product Overview: Recombinant Full Length Oryza sativa subsp. japonica CASP-like protein BLE3(BLE3) Protein (Q84UT5) (1-162aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Rice
• Source: E.coli
• Tag: His
• ProteinLength: Full Length (1-162)
• Form: Lyophilized powder
• AA Sequence: MAKVHRLMNAVLRLAAAAAAATAAVVMVTSRETTSFFGIQMEAKYSYTPSFIFFVVAYAV AAAYSLLVLAVPAGSALSRLALTTDVVLGMVLAGAVASAGAISDIAKNGNSHAGWLPVCG QIHAYCNHVMAALIAGFVALAVHFVVVMYSLHIVTDVICPCH
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: BLE3
• Synonyms: BLE3; Os05g0245300; LOC_Os05g15630; OsJ_017008; OSJNBa0037H06.9; CASP-like protein BLE3; CASP-like protein 1C2; OsCASPL1C2; Protein brassinolide-enhanced 3; OsBLE3; Protein BL-enhanced 3
• UniProt ID: Q84UT5