Recombinant Full Length Oryza Sativa Subsp. Japonica Caax Prenyl Protease 1 Homolog(Face1) Protein, His-Tagged
Cat.No. : | RFL5136OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. japonica CAAX prenyl protease 1 homolog(FACE1) Protein (Q6EPN8) (1-425aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-425) |
Form : | Lyophilized powder |
AA Sequence : | MALPYLEAVLCFMILMYIFETYLDIRQHRALKLPTLPKPLVGVISGEKFERSRAYSLDKS KFHFIHEAVTILMDTTILYYRVLPWVWKKSGELATNAGLNAENEILHTLAFLAGVMIWSQ ITDLPFSLYSTFVIEAKHGFNKQTIWLFIRDMIKGILLSILLGPPIVAAIIIIVQNGGPY LAIYLWGFMFALSLVMMTIYPIVIAPLFNKFTPLPEGVLREKIEKLAASLSFPLKKLFVV DGSTRSSHSNAYMYGFFKNKRIVLYDTLIQQCSSEDEIVSVIAHELGHWKLNHTVYSFVA VQLLMFLQFGGYTLVRNSKDLFESFGFEDQPVIIGLIIFQHTIIPVQHLLSFCLNLVSRA FEFQADAFAKNLGYAPQLRAALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLSALEDAD SKKEN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FACE1 |
Synonyms | FACE1; STE24; Os02g0680400; LOC_Os02g45650; OsJ_007668; OsJ_07930; P0663F07.25; CAAX prenyl protease 1 homolog; Farnesylated proteins-converting enzyme 1; FACE-1; Prenyl protein-specific endoprotease 1; Zinc metalloproteinase Ste24 homolog |
UniProt ID | Q6EPN8 |
◆ Recombinant Proteins | ||
RFL29895UF | Recombinant Full Length Ustilago Maydis Squalene Synthase(Erg9) Protein, His-Tagged | +Inquiry |
ELOVL7-2081R | Recombinant Rat ELOVL7 Protein | +Inquiry |
ALKBH2-475H | Recombinant Human ALKBH2 Protein, GST-tagged | +Inquiry |
PTPN1-670HFL | Recombinant Full Length Human PTPN1 Protein, C-Flag-tagged | +Inquiry |
SELL-233H | Recombinant Human SELL Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
PROC-269B | Active Native Bovine Protein C | +Inquiry |
SV40gp6-268 | Active Native Simian virus 40 SV40gp6 protein | +Inquiry |
PSA-01H | Native Human PSA-ACT Complex Protein | +Inquiry |
Lectin-1758C | Active Native Canavalia ensiformis Concanavalin A Protein, Cy3 labeled | +Inquiry |
Glycogen-016B | Native bovine liver Glycogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGMN-2893MCL | Recombinant Mouse LGMN cell lysate | +Inquiry |
CKMT1B-7482HCL | Recombinant Human CKMT1B 293 Cell Lysate | +Inquiry |
Adrenal-631B | Bovine Cortex Lysate, Total Protein | +Inquiry |
ALS2CR11-8892HCL | Recombinant Human ALS2CR11 293 Cell Lysate | +Inquiry |
FCGRT-6278HCL | Recombinant Human FCGRT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FACE1 Products
Required fields are marked with *
My Review for All FACE1 Products
Required fields are marked with *
0
Inquiry Basket