Recombinant Full Length Ustilago Maydis Squalene Synthase(Erg9) Protein, His-Tagged
Cat.No. : | RFL29895UF |
Product Overview : | Recombinant Full Length Ustilago maydis Squalene synthase(ERG9) Protein (Q92459) (1-572aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ustilago maydis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-572) |
Form : | Lyophilized powder |
AA Sequence : | MGLLSYILLGFTHPSELRAMIGYKVWRDPLNDIKANPQASGWDRQRMRDCWGFLDLTSRS FAAVIKELKGELSRVICLFYLVLRALDTVEDDMTIPAQRKIPLLVNFYKYLEQPGWNFTE SGPNEKDRQLLVEFDKVIAEYQLLDVGYKTVISDITAKMGAGMASYIELSAKGPLKVAMW KHFDLYCHFVAGLVGEGLSRLFSESKLERPWLGHQLELSNHMGLFLQKTNIIRDYAEDCE EGRYFWPQQCWGDDFAKFESQPDVAKGIIEIKPGHFRPADNELGQRSMYVLSSMLLDAMS HATHALDYLALLKEQSVFNFCAIPQVMAIATLELMFNNPDVFKKNVKIRKGVAVGLILRA VNPRDVAYTFLHYSRKMHARLSPADPNFTRWSVELARIEQWCETYYPSFIAAASEGKPTD IRANALRSWSESRRTQALILKQAKLNGSDASTLDAKSVLEAAQNSALDPRDLMTEDERAA QDKRDRDQMVKFFLIILVGMVTFMGIVALITWEIVWWWTMDTPDPLSVYVKHAYYLVKTQ GWSTVKEVLRTTRLSFEHVWKHGLTSPPKLEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ERG9 |
Synonyms | ERG9; UMAG_04374; Squalene synthase; SQS; SS; FPP:FPP farnesyltransferase; Farnesyl-diphosphate farnesyltransferase |
UniProt ID | Q92459 |
◆ Recombinant Proteins | ||
GAL4-121SH | Active Recombinant Saccharomyces cerevisiae and Human herpesvirus 2 GAL4(1-147aa)+VP16(411-490aa) protein, His-tagged | +Inquiry |
Fhl1-3011M | Recombinant Mouse Fhl1 Protein, Myc/DDK-tagged | +Inquiry |
BATF2-6155HF | Recombinant Full Length Human BATF2 Protein, GST-tagged | +Inquiry |
FAM76A-12725H | Recombinant Human FAM76A, GST-tagged | +Inquiry |
AR-1278H | Recombinant Human AR protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
DNase-24B | Active Native Bovine Deoxyribonuclease | +Inquiry |
IgGF-330C | Native Chicken IgG Fab | +Inquiry |
HSP90AA1-14H | Native Hsp90 Protein | +Inquiry |
ApoA-I-3554H | Native Human ApoA-I | +Inquiry |
CGA-8163H | Native Human Chorionic Gonadotropin | +Inquiry |
◆ Cell & Tissue Lysates | ||
WFDC2-1266CCL | Recombinant Canine WFDC2 cell lysate | +Inquiry |
CPB-278R | Rabbit Anti-GST Polyclonal Antibody | +Inquiry |
PVR-2272RCL | Recombinant Rat PVR cell lysate | +Inquiry |
C14orf126-8289HCL | Recombinant Human C14orf126 293 Cell Lysate | +Inquiry |
Bladder-31M | Mouse Bladder Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERG9 Products
Required fields are marked with *
My Review for All ERG9 Products
Required fields are marked with *
0
Inquiry Basket