Recombinant Full Length Oryza Sativa Subsp. Indica Upf0496 Protein 1 (Osi_010151) Protein, His-Tagged
Cat.No. : | RFL36680OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. indica UPF0496 protein 1 (OsI_010151) Protein (A2XDK8) (1-388aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-388) |
Form : | Lyophilized powder |
AA Sequence : | MGNSSSSGSHRPPRPASSESALPPAAAAAEELSSYEAACRSDPELRTFDTTLQRRTSRAI STLAVGVEVRSLSLESLREVTGCLLDMNQEVVRVILDCKKDIWKSPELFDLVEDYFESSL HTLDFCTALDKCLKRARDSQLLLHVALQRFDDEEDNDAAAAGQEDAAPSARYARTLHELR QFKAAGDPFTEEFFSAFQAVYRQQLTMLEKLQQRKHRLDKKVRAIKAWRRVSSIIFATTF AAVLICSVVAAAIAAPPVAAALAAAASIPVGSMGKWIDSLLKGYQDALRGQKEVVSAMQV GTFIAIKDLDSIRVLINRVELEISSMIDCVEFAERDEEAVKFGVEEIKKKLEVFMKSVED LGEQADRCSRDIRRARTVVLQRIIRHPS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OsI_010151 |
Synonyms | OsI_010151; UPF0496 protein 1 |
UniProt ID | A2XDK8 |
◆ Recombinant Proteins | ||
Cd69-902M | Recombinant Mouse Cd69 Protein, Fc-tagged | +Inquiry |
PRTN3-13534M | Recombinant Mouse PRTN3 Protein | +Inquiry |
YNEE-1385B | Recombinant Bacillus subtilis YNEE protein, His-tagged | +Inquiry |
SLC35E4-5176R | Recombinant Rat SLC35E4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL15891SF | Recombinant Full Length Synechococcus Elongatus Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
VWF-369H | Native Human Von Willebrand Factor | +Inquiry |
CALM3-74B | Native Bovine Calmodulin | +Inquiry |
RPE-426 | Native RPE | +Inquiry |
FGG -32B | Native Bovine Fibrinogen | +Inquiry |
Lectin-1836R | Native Ricinus Communis Ricin B Chain Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAP43-1911HCL | Recombinant Human GAP43 cell lysate | +Inquiry |
LIN9-987HCL | Recombinant Human LIN9 cell lysate | +Inquiry |
CHRNA1-7517HCL | Recombinant Human CHRNA1 293 Cell Lysate | +Inquiry |
ZNF136-1987HCL | Recombinant Human ZNF136 cell lysate | +Inquiry |
LYG2-4596HCL | Recombinant Human LYG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OsI_010151 Products
Required fields are marked with *
My Review for All OsI_010151 Products
Required fields are marked with *
0
Inquiry Basket