Recombinant Full Length Oryza Sativa Subsp. Indica Putative Upf0496 Protein 5 (Osi_032118) Protein, His-Tagged
Cat.No. : | RFL5114OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. indica Putative UPF0496 protein 5 (OsI_032118) Protein (A2Z6C5) (1-428aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-428) |
Form : | Lyophilized powder |
AA Sequence : | MGNRHGIMRPRRLASGRSAAAAEEEGEDGEGEPGSYEAACSADPELGTFDTALRRRASRA ITAVASGVEVRSLSLGSLREVTGCLLDMNQEVVRVVLACKRDVWRSPDLFDLVEDYFEGS LHTLDFLAALDKSLHRARDSQLVLHLAVQRHHHEPPAAAAASASELYASTLGELRQFKAA GEPFTDEFFAAFQTVYRQQMSMVGKLRRRKRRLDRRLRSVRVWRRVSGIVFLTAFAALLV CSVVAAAIAAPPVAAALAPAASMPVGSAGKWMDSLLKKYQDALHGHKEVVSAMQVGTFIA IKDLDSIRVLVEHLEVQISSMADSVEFAERDEEAVRFGIDEVKKKLELFMKSVDDLGEQA DRNNMRLCHILPEYVFFINPANGNGMSESLFEMMNAFHDICRKDIKFKTSHYYLNFLSSS YQVYIAVA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OsI_032118 |
Synonyms | OsI_032118; Putative UPF0496 protein 5 |
UniProt ID | A2Z6C5 |
◆ Native Proteins | ||
Immunoglobulin G1-81H | Native Human Immunoglobulin G1 | +Inquiry |
CKB-1177H | Native Human Creatine Kinase, Brain | +Inquiry |
SLC40A1-5335H | Native Human Solute Carrier Family 40 (iron-regulated transporter), Member 1 | +Inquiry |
IgG-018R | Native Rabbit Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
AVD-3786C | Native Chicken AVD | +Inquiry |
◆ Cell & Tissue Lysates | ||
CBX1-7807HCL | Recombinant Human CBX1 293 Cell Lysate | +Inquiry |
UBXN1-541HCL | Recombinant Human UBXN1 293 Cell Lysate | +Inquiry |
DHDH-468HCL | Recombinant Human DHDH cell lysate | +Inquiry |
HAO2-5637HCL | Recombinant Human HAO2 293 Cell Lysate | +Inquiry |
KCNMB2-5027HCL | Recombinant Human KCNMB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All OsI_032118 Products
Required fields are marked with *
My Review for All OsI_032118 Products
Required fields are marked with *
0
Inquiry Basket