Recombinant Full Length Oryza Sativa Subsp. Indica Putative Magnesium Transporter Mrs2-H(Mrs2-H) Protein, His-Tagged
Cat.No. : | RFL36156OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. indica Putative magnesium transporter MRS2-H(MRS2-H) Protein (A2XCA0) (1-435aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-435) |
Form : | Lyophilized powder |
AA Sequence : | MALPCAFLSAAAAANATSFSSSPESRRCRSVHRVPSRPRPPLAPPARVMGKGNSKRKAAN TRLWMRLDRRGGCEMILCDKSFVARRSGLPARDLRVLGPLLSRSPSILAREKAMVINLEF VRAIVTADEVLVLEPLAQEVLPFVEKLRKHFPLKSLDVDDVSTHMHTENQDGELAQDVSC YEVEGANHELPFEFQVLDFALEAVCLSYNSTISDLNRSAIAVLDDLMKSVSTRNLERVRS LKSSLTRLLASVQKVRDEVEHILDDNEAMAHLCTARKTKGQKDLLNTILFPETRLCRTHS SIENSTGIRTCVPSDSDAHILDMLLEAYFKQLDGIRNRIFLVRQYIVDTEDYISIQLDNK RNELLGLQLTLIIASFGIAINTFIAAAFAMNIPHRGYHFVIGVPFGQFVGATSFLCMSIV ILLFTYAWRNRLLCT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MRS2-H |
Synonyms | MRS2-H; OsI_09927; Putative magnesium transporter MRS2-H |
UniProt ID | A2XCA0 |
◆ Recombinant Proteins | ||
KIT-148H | Recombinant Human KIT, Fc Chimera | +Inquiry |
ABCB5-3534H | Recombinant Human ABCB5 protein, GST-tagged | +Inquiry |
RFL6461LF | Recombinant Full Length Lactobacillus Reuteri Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
NOL3-4018R | Recombinant Rat NOL3 Protein | +Inquiry |
PSTPIP2-2040H | Recombinant Human PSTPIP2, His-tagged | +Inquiry |
◆ Native Proteins | ||
HbA1c-21R | Native Rhesus monkey Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
Trf-70M | Native Mouse Apotransferrin | +Inquiry |
IgG-206M | Native Monkey Immunoglobulin G | +Inquiry |
IgG-170G | Native Goat IgG Fc fragment | +Inquiry |
Lectin-1736C | Active Native Canavalia ensiformis Concanavalin A Protein, Rhodamine labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
Skeletal Muscle-434H | Human Skeletal Muscle Membrane Lysate | +Inquiry |
EPOR-2055HCL | Recombinant Human EPOR cell lysate | +Inquiry |
HKDC1-795HCL | Recombinant Human HKDC1 cell lysate | +Inquiry |
BHMT-8458HCL | Recombinant Human BHMT 293 Cell Lysate | +Inquiry |
CAMK2A-7880HCL | Recombinant Human CAMK2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRS2-H Products
Required fields are marked with *
My Review for All MRS2-H Products
Required fields are marked with *
0
Inquiry Basket