Recombinant Full Length Oryza Sativa Subsp. Indica Putative Magnesium Transporter Mrs2-G(Mrs2-G) Protein, His-Tagged
Cat.No. : | RFL310OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. indica Putative magnesium transporter MRS2-G(MRS2-G) Protein (A2Z9W7) (1-468aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-468) |
Form : | Lyophilized powder |
AA Sequence : | MGRRSGGRKLPFFASNASTSSSTKRTRSARRLPSLTRPRASSSPSPASPSPPPPSASHPA PPSPPLAVSPAGAGKVGKKKAGARLWMRLDRWGVSETLHLDKGSIIRRAGLPPRDLRILG PVFSDSSSILAREKAMVINLEFIRAIVTADEILLLDPLTIDVIPFVEQLTHHLPLKNLVC GNGQPGGDDHGEKHDDSPGDQVPRLNEATGAEHELPFEFQVLELALETVCSSFDVNVSGL ERRATPVLEELTKNVSTRNLDRVRTLKSDLTRLLAHVQKVRDEIEHLLDDNEDMAHLYLT RKQLQNQQVEALISSAASNSIVPGGTSLSRLNNSFRRSVSIATSMHLDNDVEDLEMLLEA YFMQLDGIRNRILSVREYIDDTEDYVNIQLDNQRNELIQLQLTLTIASFGIAVNTFIAGA FAMNIQSKLYSIDDGSFFWPFVGGTSSGCFMICIVLLWYARWKKLLGP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MRS2-G |
Synonyms | MRS2-G; OsI_34529; Putative magnesium transporter MRS2-G |
UniProt ID | A2Z9W7 |
◆ Recombinant Proteins | ||
TRPA1-18H | Recombinant Human TRPA1 Protein, N-GST-tagged | +Inquiry |
CD209-643H | Recombinant Human CD209 protein, His-tagged | +Inquiry |
CD274-2330HAF555 | Recombinant Human CD274 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
Lpin1-3810M | Recombinant Mouse Lpin1 Protein, Myc/DDK-tagged | +Inquiry |
IgG-744H | Recombinant Human IgG Protein | +Inquiry |
◆ Native Proteins | ||
IL16-29736TH | Native Human IL16 | +Inquiry |
IgG-008G | Native Guinea Pig Whole Molecule IgG, Biotin Conjugated | +Inquiry |
LYZ-249H | Active Native Human Lysozyme | +Inquiry |
MHC-239H | Native Human Myosin Heavy Chain | +Inquiry |
ECV-309S | Native Snake ECV- PROTHROMBIN ACTIVATOR | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM32A-6384HCL | Recombinant Human FAM32A 293 Cell Lysate | +Inquiry |
TRUB1-728HCL | Recombinant Human TRUB1 293 Cell Lysate | +Inquiry |
GPX1-5763HCL | Recombinant Human GPX1 293 Cell Lysate | +Inquiry |
PTPLAD2-2688HCL | Recombinant Human PTPLAD2 293 Cell Lysate | +Inquiry |
NBPF22P-4333HCL | Recombinant Human MGC48637 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRS2-G Products
Required fields are marked with *
My Review for All MRS2-G Products
Required fields are marked with *
0
Inquiry Basket