Recombinant Full Length Oryza Sativa Subsp. Indica Bidirectional Sugar Transporter Sweet12(Sweet12) Protein, His-Tagged
Cat.No. : | RFL3409OF |
Product Overview : | Recombinant Full Length Oryza sativa subsp. indica Bidirectional sugar transporter SWEET12(SWEET12) Protein (A2XGM7) (1-300aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rice |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-300) |
Form : | Lyophilized powder |
AA Sequence : | MVQALVFAVGIVGNILSFLVILAPVPTFYRVYKKKSTESFQSVPYAVALLSAMLWLYYAL LTSDLLLLSINSIGCLVESLYLTVYLLYAPRQAMAFTLKLVCAMNLALFAAVVAALQLLV KATDRRVTLAGGIGASFALAVFVAPLTIIRQVIRTKSVEFMPFWLSFFLTLSAVVWFFYG LLMKDFFVATPNVLGLLFGLAQMVLYVVYKDPKKNSAVSEAAAAQQVEVKDQQQLQMQLQ ASPAVAPLDVDADADADLEAAAPATPQRPADDDAIDHRSVVVDIPPPPQPPPALPAVEVA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SWEET12 |
Synonyms | SWEET12; OsI_11551; Bidirectional sugar transporter SWEET12; OsSWEET12 |
UniProt ID | A2XGM7 |
◆ Native Proteins | ||
MLC-240H | Native Human Myosin Light Chain | +Inquiry |
UMOD-91P | Native Porcine UMOD | +Inquiry |
APOC2-27331TH | Native Human APOC2 protein | +Inquiry |
C3-365H | Active Native Human C3 Protein | +Inquiry |
VWF-369H | Native Human Von Willebrand Factor | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP8-2054HCL | Recombinant Human MMP8 cell lysate | +Inquiry |
TBC1D2-1739HCL | Recombinant Human TBC1D2 cell lysate | +Inquiry |
CAPN7-7860HCL | Recombinant Human CAPN7 293 Cell Lysate | +Inquiry |
PLUNC-3093HCL | Recombinant Human PLUNC 293 Cell Lysate | +Inquiry |
GPR148-5796HCL | Recombinant Human GPR148 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SWEET12 Products
Required fields are marked with *
My Review for All SWEET12 Products
Required fields are marked with *
0
Inquiry Basket