Recombinant Full Length Orientia Tsutsugamushi 56 Kda Type-Specific Antigen Protein, His-Tagged
Cat.No. : | RFL30833OF |
Product Overview : | Recombinant Full Length Orientia tsutsugamushi 56 kDa type-specific antigen Protein (P37919) (23-522aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Orientia tsutsugamushi (Rickettsia tsutsugamushi) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (23-522) |
Form : | Lyophilized powder |
AA Sequence : | IELGDEGVLECGPYAKIGVVGGMVTGVESARLDPADVDCKKHLSLTTMLPFGGTLAAGMT IAPGFRAELGVMYLRNINAEVELGEGKTGSGAANAAIDTGAPIRKRFKLTPPQPTIMPIS IADRDLGVDTDILAQAAVGQQQLTVEQRAEDRIAWLKNYAGIDYMVPDSQNPNARVVNPV LLNITQGAPNVNPRPRQNLNILDHDQWRYLVVGVTALSNANKPSVSSVKVLSDKITQIYS DIRQFAKIANIEVPGAPLPNSASVEQIQTKMQELNDVLEELRESFDGYLANAFANQIQLN FQIQQAQQQQQQQQQGQVTAQEAAAAAAVRALNGNEQIIQLYKDLVKLQRHAGIRKAMEK LAAQEEGDDQSQVSCNDKKQQAVAEDSKAGSSKEGKNKEVELDLSMIVAQVKLYADVVAT ESFSIYIGGGVGVARTYGDIDGKSVKHIGVVASGVLGVAINVADGVCVDIDGGYMHSFSK IEDKYSVNAFIANAGVRYNF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Orientia tsutsugamushi 56 kDa type-specific antigen |
Synonyms | 56 kDa type-specific antigen; TSA; 56 kDa scrub typhus antigen; STA56; TSW56 |
UniProt ID | P37919 |
◆ Recombinant Proteins | ||
NCR3LG1-706H | Active Recombinant Human NCR3LG1, Fc Chimera | +Inquiry |
CDH16-0976H | Recombinant Human CDH16 Protein, GST-Tagged | +Inquiry |
COG1-1620H | Recombinant Human COG1 Protein, GST-tagged | +Inquiry |
MT2A-7000HF | Recombinant Full Length Human MT2A Protein, GST-tagged | +Inquiry |
PDGFD-1526C | Recombinant Cynomolgus PDGFD protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Ferritin-181R | Native Rat Ferritin | +Inquiry |
FGB-56R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
Thrombin-25H | Active Native Human β-thrombin | +Inquiry |
Bilirubin-156P | Native Porcine Bilirubin | +Inquiry |
CKB-8079H | Active Native Human CKB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C10orf53-70HCL | Recombinant Human C10orf53 lysate | +Inquiry |
IL37-5237HCL | Recombinant Human IL1F7 293 Cell Lysate | +Inquiry |
CKM-7483HCL | Recombinant Human CKM 293 Cell Lysate | +Inquiry |
NHP2-3831HCL | Recombinant Human NHP2 293 Cell Lysate | +Inquiry |
FBXL5-6310HCL | Recombinant Human FBXL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Orientia tsutsugamushi 56 kDa type-specific antigen Products
Required fields are marked with *
My Review for All Orientia tsutsugamushi 56 kDa type-specific antigen Products
Required fields are marked with *
0
Inquiry Basket