Recombinant Full Length Oligopeptide Transport System Permease Protein Amic(Amic) Protein, His-Tagged
Cat.No. : | RFL16780SF |
Product Overview : | Recombinant Full Length Oligopeptide transport system permease protein AmiC(amiC) Protein (P0A4M7) (1-498aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptococcus pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-498) |
Form : | Lyophilized powder |
AA Sequence : | MKKYIFMRVLRSLVSIFLVTTLTYTIIYTLVPRKLIFKQDPNYNKIATTADKRDNYENTV FERMGYIEYYDTKELQEKASSMDSSVTVEANATNKAIYEKYINQLGHGWTLGEFTESGQF YATREIPIFERVFHFYANLIDIDHTNKIQDPENPDLKRYLRFENDPAIGWSLVGSGTKHK YLLYFNSQFPFVHQNFVNLNLGDSYPTYANTPVLQVITQGQGQTKTAQVQFPTGKKTSSV NIYSRTYKSPSQADSREVASYGKDDPYTATESNYQYPSMIVSSAITGLIGLVLAYALAVP LGSAMARFKNTWIDSLSTGALTFLLALPTIALVYIVRLIGSSIALPDSFPILGAGDWRSY VLPAVILGLLGAPGTAIWIRRYMIDLQSQDFVRFARAKGLSEKEISNKHIFKNAMVPLVS GIPAAIIGVIGGATLTETVFAFPGMGKMLIDSVKASNNSMVVGLVFIFTCISIFSRLLGD IWMTIIDPRIKLTEKGGK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | amiC |
Synonyms | amiC; SP_1890; Oligopeptide transport system permease protein AmiC |
UniProt ID | P0A4M7 |
◆ Recombinant Proteins | ||
TM4SF19-1031H | Recombinant Human TM4SF19 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SCO6415-1012S | Recombinant Streptomyces coelicolor A3(2) SCO6415 protein, His-tagged | +Inquiry |
HSV-1-1075v | Recombinant Herpes simplex virus, type 1 gG Protein | +Inquiry |
Spike-4793V | Active Recombinant COVID-19 Spike Protein, His Tag (BA.2/Omicron), His-tagged | +Inquiry |
TPO-05H | Recombinant Human TPO Protein, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
Troponin I-12H | Native Human Troponin I protein | +Inquiry |
Mb-8229M | Native Mouse Myoglobin | +Inquiry |
CA2-30H | Native Human Carbonic Anhydrase II (CA2) Protein | +Inquiry |
Thrombin-25H | Active Native Human β-thrombin | +Inquiry |
Egf -634M | Active Native Mouse Egf protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
STIP1-641HCL | Recombinant Human STIP1 lysate | +Inquiry |
INTS4-864HCL | Recombinant Human INTS4 cell lysate | +Inquiry |
IFI44-5292HCL | Recombinant Human IFI44 293 Cell Lysate | +Inquiry |
MAGEA1-4558HCL | Recombinant Human MAGEA1 293 Cell Lysate | +Inquiry |
SSR1-1459HCL | Recombinant Human SSR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All amiC Products
Required fields are marked with *
My Review for All amiC Products
Required fields are marked with *
0
Inquiry Basket