Recombinant Full Length Nucleoporin Ndc-1(Npp-22) Protein, His-Tagged
Cat.No. : | RFL7635CF |
Product Overview : | Recombinant Full Length Nucleoporin ndc-1(npp-22) Protein (Q8I4N3) (1-588aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-588) |
Form : | Lyophilized powder |
AA Sequence : | MMGDSHSSFTTTTDEHLYNQFSPGRRKNDFPAASSSSSSPNLRRSPNRTVSSPRVQQKPI TIFDQIVDWFQAEISVRKRLAGAACGYLSTIFFIVTVSILKLTIWAPFSSVQDSLAWWIY PNAWASIIFVGIASVAMSLFSIIKFCKVDQLPRLAATDTFALAGVALEFVTRLTFVYTAF CVADFSFSREFAFVAISLAIAISSALVVFRSDYQLNFSHIQVNSVKTLIDFGTSLPYANI SEICGIDAAISYTAAVALILVVGPMVSGFSAWWLLLNIPFHVVLFGLCFTQQFYSKISMK IVNQIVMKPISFPFPPPYTVHSPTPEQTRTLPNVIETDDSLLKFFALHDLRTIAWNDEKR RVDVFSLSQPGKHPRNWKAVSLPCVRMLDELCSRMTVSAARLVGYSWDDHDIENEDVPRD ALLMPRKMREMAYRGTGQSRQQKSMAPIRSHNTQTVGLLSKISNFLGFGVTEKLVISRFD AHMNAYAAEALYMLVVDSMGEDRFGVVQKDLKDLITLLCKLIAAIDTYERAKASVADKSD VTFLRIVDASLKSSLQRVVTTFGSHLSSLNLPEEHSRTIRMICLTDEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | npp-22 |
Synonyms | npp-22; ndc-1; B0240.4; Nucleoporin ndc-1; Nucleoporin npp-22 |
UniProt ID | Q8I4N3 |
◆ Native Proteins | ||
CA2-32S | Native Sheep Carbonic Anhydrase II (CA2) Protein | +Inquiry |
PGK-100Y | Active Native Yeast 3-Phosphoglyceric Phosphokinase | +Inquiry |
IgY-006D | Native Duck IgY | +Inquiry |
F5-1176H | Native Human Coagulation Factor V, FITC conjugated | +Inquiry |
FGB-31B | Native Bovine Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
DERL1-6971HCL | Recombinant Human DERL1 293 Cell Lysate | +Inquiry |
A-20-155H | A-20 Whole Cell Lysate | +Inquiry |
SOD2-1574HCL | Recombinant Human SOD2 293 Cell Lysate | +Inquiry |
C5orf20-250HCL | Recombinant Human C5orf20 cell lysate | +Inquiry |
CHRNA7-7514HCL | Recombinant Human CHRNA7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All npp-22 Products
Required fields are marked with *
My Review for All npp-22 Products
Required fields are marked with *
0
Inquiry Basket