Recombinant Full Length Nuclear Envelope Phosphatase-Regulatory Subunit 1 Homolog(T19A6.3) Protein, His-Tagged
Cat.No. : | RFL24193CF |
Product Overview : | Recombinant Full Length Nuclear envelope phosphatase-regulatory subunit 1 homolog(T19A6.3) Protein (Q9XXN3) (1-140aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-140) |
Form : | Lyophilized powder |
AA Sequence : | MAIQARRMPEDPSTACEDLKFFEKRLTEVITYMGPTCTRWRIAIVIFAVLVGVIGSKYFA NEKIEIFQIPMIDMFLTTHLDFTLCFFVGLLLFAVFGVHRRIVAPTIVARRCRDALSPFS LSCDHNGKLIVKPAVRNSAP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | T19A6.3 |
Synonyms | nepr-1; T19A6.3; Nuclear envelope phosphatase-regulatory subunit 1 homolog; NEP1-R1; Transmembrane protein 188 |
UniProt ID | Q9XXN3 |
◆ Native Proteins | ||
HSV-2ag-268V | Active Native HSV-2 Protein | +Inquiry |
FLNA-873T | Native Turkey FLNA Protein | +Inquiry |
LDL-404H | Native Human Low Density Lipoprotein, Oxidized, Biotin labeled | +Inquiry |
Ferritin-024B | Native Bovine Ferritin Protein, holo form | +Inquiry |
CFH-23H | Active Native Human Complement factor H | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAPGEFL1-2519HCL | Recombinant Human RAPGEFL1 293 Cell Lysate | +Inquiry |
HSD17B8-5371HCL | Recombinant Human HSD17B8 293 Cell Lysate | +Inquiry |
SERPINC1-1725CCL | Recombinant Cynomolgus SERPINC1 cell lysate | +Inquiry |
DNAL4-6868HCL | Recombinant Human DNAL4 293 Cell Lysate | +Inquiry |
CLTA-7429HCL | Recombinant Human CLTA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All T19A6.3 Products
Required fields are marked with *
My Review for All T19A6.3 Products
Required fields are marked with *
0
Inquiry Basket