Recombinant Full Length Nostoc Sp. Proton Extrusion Protein Pcxa(Pcxa) Protein, His-Tagged
Cat.No. : | RFL28386NF |
Product Overview : | Recombinant Full Length Nostoc sp. Proton extrusion protein PcxA(pcxA) Protein (Q8YWE0) (1-467aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nostoc sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-467) |
Form : | Lyophilized powder |
AA Sequence : | MPTMRNSIFSEKIYPILLSAYRWYLRTPERSLEEAYKAALNIKAIEDEHFNGNKIDFNSA IYSNSVMDYFESDLAQELKTARMRLTEFRFSRWFSNESHQKAARKAGIEYPSSNVTLEKL KFIDEVISKYIITDYEIVAPSGVSESQVRTTSSQPPENPSLTDALRTNDINKNNLVERIY TPTSPPQLIKQRTEQSKKSRGKADTTGILPRSILSTIGRLQIELDPNAEQDVINNFRQAQ KRSIISIRFILLIIIVPLLTHQLSKALIVSPIFNHFKNDHTEQIFLNSEMEEEALSTLHR FEERIKFENLISNAPPLSAEAIETQIKEKAEELAAEFRGESSNAIKNVFADIFSVGAFIW LLLVSKPSIMVLKEFFDNVVYGLSDSAKAFIIILFTDVFVGFHSPHGWEVILEGLSRHWG LPANRDFIFLFIATFPVILDTIFKYWIFRYLNRISPSAVATYRNMNE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pcxA |
Synonyms | pcxA; all1673; Proton extrusion protein PcxA |
UniProt ID | Q8YWE0 |
◆ Native Proteins | ||
CXCL1-27707TH | Native Human CXCL1 | +Inquiry |
MAP-30 | Native Mytilus edulis MAP Protein | +Inquiry |
Collagen-121B | Native Bovine Type II Collagen, FITC-tagged | +Inquiry |
Complement C3d-48H | Native Human Complement C3d | +Inquiry |
Lectin-1855V | Active Native Vicia Villosa Lectin Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
GIMAP8-5935HCL | Recombinant Human GIMAP8 293 Cell Lysate | +Inquiry |
MRPS16-4149HCL | Recombinant Human MRPS16 293 Cell Lysate | +Inquiry |
ZNF683-2075HCL | Recombinant Human ZNF683 cell lysate | +Inquiry |
RPS3-563HCL | Recombinant Human RPS3 lysate | +Inquiry |
TRIM6-765HCL | Recombinant Human TRIM6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pcxA Products
Required fields are marked with *
My Review for All pcxA Products
Required fields are marked with *
0
Inquiry Basket