Recombinant Full Length Anabaena Variabilis Proton Extrusion Protein Pcxa(Pcxa) Protein, His-Tagged
Cat.No. : | RFL4881AF |
Product Overview : | Recombinant Full Length Anabaena variabilis Proton extrusion protein PcxA(pcxA) Protein (Q3MDY0) (1-467aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Anabaena variabilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-467) |
Form : | Lyophilized powder |
AA Sequence : | MPTMRNSIFSEKVYPILLSAYRWYLRTPERSLEEAYKAALNIKAIEDEHFNGNKIDFNSA IYSNSVMDYFESDLAQELKTARMRLTEFRFSRWFSNESHQKAARKAGIEYPSSTVILEKL KFIDEIISKYIITDYEIAAPSGASDLQVRTTSLQPPENPSLTDSLRNNDINKNNLVERIY TPTSPPQLIRPRTEQNKKPRGKADTTGILPRSILSTIGRLQIELDPNSEQDVINNFRQAQ KRSIISIRFILLLIIVPLLTHQLSKALIVSPIFNHFKKADTEQIFLNSEMEEEALSTLHR FEERIKFENLISNAPPLSAEAIETQIKEKAEEIAAEFRGESANAIKNVFADIFSVGAFIW LLLVSKPSIMVLKEFFDNVVYGLSDSAKAFIIILFTDVFVGFHSPHGWEVILEGLSRHWG LPANRDFIFLFIATFPVILDTIFKYWIFRYLNRISPSAVATYRNMNE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pcxA |
Synonyms | pcxA; cemA; Ava_1182; Proton extrusion protein PcxA |
UniProt ID | Q3MDY0 |
◆ Recombinant Proteins | ||
FLNC-4359H | Recombinant Human FLNC Protein, GST-tagged | +Inquiry |
LDOC1-2491R | Recombinant Rhesus monkey LDOC1 Protein, His-tagged | +Inquiry |
CCL11-1406H | Recombinant Human CCL11 Protein (Gly24-Pro97) | +Inquiry |
SCP2D1-1169H | Recombinant Human SCP2D1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ASCL3-902H | Recombinant Human ASCL3 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
VTN-2H | Native Human monomeric vitronectin, Biotin labeled | +Inquiry |
Lung-017H | Human Lung Lysate, Total Protein | +Inquiry |
FABP1-509H | Native Human FABP1 | +Inquiry |
FSME-07 | Native FSME (TBE) Virus Antigen | +Inquiry |
LDH-215S | Active Native Porcine Lactate Dehydrogenase | +Inquiry |
◆ Cell & Tissue Lysates | ||
EMR1-554HCL | Recombinant Human EMR1 cell lysate | +Inquiry |
COG1-378HCL | Recombinant Human COG1 cell lysate | +Inquiry |
PAQR9-1282HCL | Recombinant Human PAQR9 cell lysate | +Inquiry |
DDRGK1-7023HCL | Recombinant Human DDRGK1 293 Cell Lysate | +Inquiry |
HIST1H1B-5554HCL | Recombinant Human HIST1H1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pcxA Products
Required fields are marked with *
My Review for All pcxA Products
Required fields are marked with *
0
Inquiry Basket