Recombinant Full Length Nostoc Sp. Potassium-Transporting Atpase B Chain 2(Kdpb2) Protein, His-Tagged
Cat.No. : | RFL3264NF |
Product Overview : | Recombinant Full Length Nostoc sp. Potassium-transporting ATPase B chain 2(kdpB2) Protein (Q8YSD5) (1-708aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nostoc sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-708) |
Form : | Lyophilized powder |
AA Sequence : | MRSPSRLPHETRDSRQRTPKTDMRGLYQRAIKESFVKLHPKIAVRNPVMFIVWVGTIVTF LVTLNPNLFGTVQANINQQRLLNGLITLILFFTVLFANFAEAVAEGRGKAQADSLKATRS DTIAWKVLPNGSLEKIGSTQLRRGDVIKVVANDMIPGDGEVIQGIGSVDESAITGESAPV LKQPGTDIASSVTGGTRLLSDELIIRITADPGQGFIDRMISLVEGAERSKTPNEIALTVL LAVLTQVFLIVVATMPSFVNYIANFISTAFGAEAANSLRAGASIAILISLLVALIPTTIG GLLSAIGIAGMDRVAQFNVIATSGRAVEACGDINSLVLDKTGTITFGNRMADEFIPVNSY TVEDVARIAKLASLFDETPEGKSIVKLAEKYKILADVNLNQAEGVEFSAKTRMSGTNLPN GKQVRKGAVDAIKGFIRSRGGSIPSDVDVAYERVSLLGGTPLAVCQDNEIFGVIYLKDIV KSGLRERFEQLRRMGVKTIMLTGDNHITASVIAQEAGVDDFIAEATPEDKIDVIRNEQSQ GKLVAMTGDGTNDAPALAQANVGLAMNSGTQAAKEAANMVDLDSDPTKLIDLVTIGKQLL ITRGALTTFSIANDIAKYFAILPTIFGAAGIGALNIMGLKSAQSAIISALIYNALIIPAL IPLALQGVKFRSLTADQLLRRNIFIYGLGGIIAPFIAIKLIDVILPFS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | kdpB2 |
Synonyms | kdpB2; all3153; Potassium-transporting ATPase ATP-binding subunit 2; ATP phosphohydrolase [potassium-transporting] B chain 2; Potassium-binding and translocating subunit B 2; Potassium-translocating ATPase B chain 2 |
UniProt ID | Q8YSD5 |
◆ Recombinant Proteins | ||
AYP1020-RS01290-5141S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS01290 protein, His-tagged | +Inquiry |
CNOT4-1938HF | Recombinant Full Length Human CNOT4 Protein, GST-tagged | +Inquiry |
SEMA4C-14868M | Recombinant Mouse SEMA4C Protein | +Inquiry |
ZDHHC8-5096R | Recombinant Rhesus Macaque ZDHHC8 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXXC5-1119R | Recombinant Rhesus monkey CXXC5 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
COL2A1-16C | Native Chicken COL2A1 Protein | +Inquiry |
ELANE-001H | Active Native Human ELANE Protein | +Inquiry |
YFP-101 | Yellow Fluorescent Protein | +Inquiry |
FSH-185H | Active Native Human Follicle Stimulating Hormone(FSH) protein | +Inquiry |
RWV-307S | Native Snake RVV-V ACTIVATOR | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPINLW1-1508HCL | Recombinant Human SPINLW1 293 Cell Lysate | +Inquiry |
C10orf46-197HCL | Recombinant Human C10orf46 cell lysate | +Inquiry |
TUSC2-636HCL | Recombinant Human TUSC2 293 Cell Lysate | +Inquiry |
TERF1-528HCL | Recombinant Human TERF1 cell lysate | +Inquiry |
FAM125B-6437HCL | Recombinant Human FAM125B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All kdpB2 Products
Required fields are marked with *
My Review for All kdpB2 Products
Required fields are marked with *
0
Inquiry Basket