Recombinant Full Length Nostoc Sp. Photosystem Q(B) Protein 2 Protein, His-Tagged
Cat.No. : | RFL19841NF |
Product Overview : | Recombinant Full Length Nostoc sp. Photosystem Q(B) protein 2 Protein (P31694) (1-344aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nostoc sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-344) |
Form : | Lyophilized powder |
AA Sequence : | MTATLQQRKSANVWEQFCEWITSTNNRLYIGWFGVLMIPTLLAATTCFIIAFIAAPPVDI DGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFL TGVFCYLGREWELSYRLGMRPWICLAFSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTENESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRQLHFFLAAWPVIGIWFTALGVSTMAFNLNGF NFNQSIIDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbA2 |
Synonyms | psbA2; psbA-2; psbAII; alr3727; psbA3; psbA-3; psbAIII; alr4592; psbA4; psbA-4; psbAIV; all3572; Photosystem II protein D1 2; PSII D1 protein 2; Photosystem II Q(B protein 2 |
UniProt ID | P31694 |
◆ Recombinant Proteins | ||
NME3-202H | Active Recombinant Human NME3 protein, His-tagged | +Inquiry |
PTX3-1807H | Recombinant Human PTX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Wdr36-6978M | Recombinant Mouse Wdr36 Protein, Myc/DDK-tagged | +Inquiry |
SYVN1-16347M | Recombinant Mouse SYVN1 Protein | +Inquiry |
DNAJB12-4685M | Recombinant Mouse DNAJB12 Protein | +Inquiry |
◆ Native Proteins | ||
HYAL1-39B | Active Native Bovine Hyaluronidase | +Inquiry |
Plasmin-251H | Active Native Human Plasmin | +Inquiry |
MV-01 | Native Measles Virus Antigen (Premium) | +Inquiry |
H3N2-01I | Active Native IAV H3N2 Protein | +Inquiry |
GALT-10 | Active Native Streptoverticillium mobaraense | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDEL1-3937HCL | Recombinant Human NDEL1 293 Cell Lysate | +Inquiry |
ZNF44-2027HCL | Recombinant Human ZNF44 cell lysate | +Inquiry |
PCK1-3379HCL | Recombinant Human PCK1 293 Cell Lysate | +Inquiry |
Small Intestine-449C | Cynomolgus monkey Small intestine Lysate | +Inquiry |
MAGEA11-4557HCL | Recombinant Human MAGEA11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbA2 Products
Required fields are marked with *
My Review for All psbA2 Products
Required fields are marked with *
0
Inquiry Basket