Recombinant Full Length Anabaena Variabilis Photosystem Q(B) Protein 2(Psba2) Protein, His-Tagged
Cat.No. : | RFL2463AF |
Product Overview : | Recombinant Full Length Anabaena variabilis Photosystem Q(B) protein 2(psbA2) Protein (Q3MAB1) (1-344aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Anabaena variabilis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-344) |
Form : | Lyophilized powder |
AA Sequence : | MTATLQQRKSANVWEQFCEWITSTNNRLYIGWFGVLMIPTLLAATTCFIIAFIAAPPVDI DGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFL TGVFCYLGREWELSYRLGMRPWICLAFSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTENESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRQLHFFLAAWPVIGIWFTALGVSTMAFNLNGF NFNQSIIDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbA2 |
Synonyms | psbA2; Ava_1597; psbA4; Ava_2460; psbA5; Ava_3553; Photosystem II protein D1 2; PSII D1 protein 2; Photosystem II Q(B protein 2 |
UniProt ID | Q3MAB1 |
◆ Recombinant Proteins | ||
CHCHD4-1209H | Recombinant Human CHCHD4 Protein, GST-Tagged | +Inquiry |
gD-460V | Recombinant HSV-1 gD Protein | +Inquiry |
GATA3-5436HFL | Recombinant Full Length Human GATA3 protein, Flag-tagged | +Inquiry |
HSPA14-499H | Recombinant Human HSPA14 Protein, His-tagged | +Inquiry |
HA-1601I | Recombinant Influenza A H1N1 (A/Swine/Wisconsin/136/1997) HA protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Placenta-020H | Human Placenta Lysate, Total Protein | +Inquiry |
VZV-04 | Native Varicella Zoster Virus (VZV) Antigen | +Inquiry |
FBb-16H | Native Human FBb protein | +Inquiry |
F11-2466H | Native Human Coagulation Factor XI | +Inquiry |
Lectin-1858V | Active Native Vicia Villosa Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Stomach-Corpus-497H | Human Stomach-Corpus Membrane Lysate | +Inquiry |
CKLF-242H | C32 (human amelanotic melanoma) nuclear extract lysate | +Inquiry |
GATS-690HCL | Recombinant Human GATS cell lysate | +Inquiry |
TSPAN8-1064HCL | Recombinant Human TSPAN8 cell lysate | +Inquiry |
KIR3DX1-981HCL | Recombinant Human KIR3DX1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbA2 Products
Required fields are marked with *
My Review for All psbA2 Products
Required fields are marked with *
0
Inquiry Basket