Recombinant Full Length Nostoc Sp. Cytochrome C Biogenesis Protein Ccsb(Ccsb) Protein, His-Tagged
Cat.No. : | RFL36321NF |
Product Overview : | Recombinant Full Length Nostoc sp. Cytochrome c biogenesis protein CcsB(ccsB) Protein (Q9R6Y2) (1-461aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nostoc sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-461) |
Form : | Lyophilized powder |
AA Sequence : | MTTDNSAPTASPWWSLPGKFLRREFLPVLTDLRLAIALLLIIALFSISGTVIEQGQSPAF YQSNYPEHPALFGFLTWKVIQVVGLDHVYRTWWFLSLLVLFGTSLTACTFTRQLPALKTA QRWKYYEEPRQFQKLALSAELDAGSVNSLSQILQNRRYKIFQEKDDILYARKGIVGRIGP IIVHIGIVTILLGSIWGAMTGFIAQEMVPSGETFQVKNIIDAGPLAAGQFPQDWSVRVNR FWIDYTPKGGIDQFYSDMSVLDNQGQEVDHKKIFVNQPLRYHGVTFYQTDWGISGVRVRL NKSPIFQLPMALLNTNGQGRIWGTWIPTKPDLSEGVSLLAKDLQGMVLIYDAQGKLVDTV RAGMSTQVNGVTLKVLDVVGSTGLQIKADPGIPIVYTGFGILMLGVVMSYFSHSQIWALQ KGDRLYVGGKTNRAQVAFEQEVLDILERLNSQSATVINQQS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ccsB |
Synonyms | ccsB; ccs1; alr3123; Cytochrome c biogenesis protein CcsB |
UniProt ID | Q9R6Y2 |
◆ Native Proteins | ||
IBV-06I | Native Influenza B Antigen | +Inquiry |
LRG1-240H | Native Human Leucine-rich Alpha 2 Glycoprotein-1 (LRG1) | +Inquiry |
Lectin-1834R | Active Native Ricinus Communis Agglutinin II Protein | +Inquiry |
FN1-4399H | Native Human FN1 Protein | +Inquiry |
MB-30275TH | Native Human MB | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCL2L13-61HCL | Recombinant Human BCL2L13 lysate | +Inquiry |
PLEKHM1P-1021HCL | Recombinant Human PLEKHM1P cell lysate | +Inquiry |
PDGFRA-2657HCL | Recombinant Human PDGFRA cell lysate | +Inquiry |
HINT1-5558HCL | Recombinant Human HINT1 293 Cell Lysate | +Inquiry |
HMGXB4-5470HCL | Recombinant Human HMGXB4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ccsB Products
Required fields are marked with *
My Review for All ccsB Products
Required fields are marked with *
0
Inquiry Basket