Recombinant Full Length Nostoc Punctiforme Cytochrome B559 Subunit Alpha(Psbe) Protein, His-Tagged
Cat.No. : | RFL14933NF |
Product Overview : | Recombinant Full Length Nostoc punctiforme Cytochrome b559 subunit alpha(psbE) Protein (B2J6T0) (1-82aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nostoc punctiforme |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-82) |
Form : | Lyophilized powder |
AA Sequence : | MSGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDAFGTPRPNEYFTPAR QEVPIVKNRFEAKKQVEQFIGK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbE |
Synonyms | psbE; Npun_F5551; Cytochrome b559 subunit alpha; PSII reaction center subunit V |
UniProt ID | B2J6T0 |
◆ Recombinant Proteins | ||
PDCD10-0880H | Recombinant Human PDCD10 Protein (M1-A212), His/Strep tagged | +Inquiry |
BLVRA-993R | Recombinant Rat BLVRA Protein | +Inquiry |
CSNK2B-23H | Recombinant Human casein kinase 2, beta polypeptide | +Inquiry |
FXYD7-3782H | Recombinant Human FXYD7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Rab33a-5309M | Recombinant Mouse Rab33a Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
CGA-8162H | Native Human Pregnancy Chorionic Gonadotropin | +Inquiry |
NEFH-181B | Native Bovine NEFH Protein | +Inquiry |
Ren -72R | Recombinant Rat Prorenin, His tag | +Inquiry |
MG-202H | Native Human Menopausal Gonadotropin | +Inquiry |
IgM-344D | Native Donkey IgM | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSGA13-705HCL | Recombinant Human TSGA13 lysate | +Inquiry |
DDR2-1296RCL | Recombinant Rat DDR2 cell lysate | +Inquiry |
GAB1-6076HCL | Recombinant Human GAB1 293 Cell Lysate | +Inquiry |
ASS1-8640HCL | Recombinant Human ASS1 293 Cell Lysate | +Inquiry |
ZBED1-222HCL | Recombinant Human ZBED1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbE Products
Required fields are marked with *
My Review for All psbE Products
Required fields are marked with *
0
Inquiry Basket