Recombinant Full Length Synechococcus Sp. Cytochrome B559 Subunit Alpha(Psbe) Protein, His-Tagged
Cat.No. : | RFL36457SF |
Product Overview : | Recombinant Full Length Synechococcus sp. Cytochrome b559 subunit alpha(psbE) Protein (Q2JS34) (1-81aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-81) |
Form : | Lyophilized powder |
AA Sequence : | MAGNTGERPFVDIITSVRYWVIHALTIPALFLAGWLFVSTGLAYDIFGTPRPNEYFTAER QELPIVSDRFNALEQLEKLTR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbE |
Synonyms | psbE; CYA_2430; Cytochrome b559 subunit alpha; PSII reaction center subunit V |
UniProt ID | Q2JS34 |
◆ Native Proteins | ||
CAPN2-121B | Native Bovine CAPN2 | +Inquiry |
Collagen Type I-09B | Native Bovine Collagen Type I Protein | +Inquiry |
F10-5395R | Active Native Rat Coagulation Factor X | +Inquiry |
Angiostatin-28H | Active Native Human Angiostatin K1-4 | +Inquiry |
L. pneumophila-26 | Native Legionella pneumophila Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
TTC39B-675HCL | Recombinant Human TTC39B 293 Cell Lysate | +Inquiry |
RSPH9-253HCL | Recombinant Human RSPH9 cell lysate | +Inquiry |
RPP30-2179HCL | Recombinant Human RPP30 293 Cell Lysate | +Inquiry |
PIDD1-4657HCL | Recombinant Human LRDD 293 Cell Lysate | +Inquiry |
UBR2-1876HCL | Recombinant Human UBR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbE Products
Required fields are marked with *
My Review for All psbE Products
Required fields are marked with *
0
Inquiry Basket