Recombinant Full Length Nodulation Protein E(Node) Protein, His-Tagged
Cat.No. : | RFL22803RF |
Product Overview : | Recombinant Full Length Nodulation protein E(nodE) Protein (P04684) (1-401aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhizobium leguminosarum bv. trifolii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-401) |
Form : | Lyophilized powder |
AA Sequence : | MDRRVVITGIGGLCGLGTNAASIWKEMREGPSAISPIITTDLYDLEGTVGLEIKAIPEHD IPRKQLVSMDRFSLLAVIAATEAMKQAGLSCDEQNAHRFGAAMGLGGPGWDTIEETYRSI LLDGVTRARIFTAPKGMPSAAAGHVSIFLGLRGPVFGVTSACAAGNHAIASAVDQIRLGR ADVMLAGGSDAPLTWGVLKSWEALRVLAPDTCRPFSADRKGVVLGEGAGMAVLESYEHAA ARGATMLAEVAGIGLSGDAYDIVMPSIEGPEAAMRSCLADAELNPDDVDYLNAHGTGTVA NDEMETAAIKRVFGDHAFQMSVSSTKSMHAHCLGAASALEMIACVMAIQEGVIPPTANYR EPDPQCDLDVTPNVPREQRCGSMSNAFAMGGTNAVLAFRQV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nodE |
Synonyms | nodE; hsnB; Nodulation protein E; Host-specificity of nodulation protein B |
UniProt ID | P04684 |
◆ Recombinant Proteins | ||
KCNV2-8557M | Recombinant Mouse KCNV2 Protein | +Inquiry |
PA2G4-1501H | Recombinant Human PA2G4, His-tagged | +Inquiry |
RFL9621MF | Recombinant Full Length Marchantia Polymorpha Photosystem Ii Reaction Center Protein Z(Psbz) Protein, His-Tagged | +Inquiry |
LRP5-285H | Active Recombinant Human LRP5 protein, hFc-tagged | +Inquiry |
NUC-016 | Recombinant Human Nucleosome, H3K4me3, K9,14,18ac dNuc, Biotinylated | +Inquiry |
◆ Native Proteins | ||
LDH1-18H | Native Human Lactate Dehydrogenase 1 | +Inquiry |
F2-275B | Active Native Bovine α-Thrombin-DFP | +Inquiry |
C9-58H | Native Human Complement C9 | +Inquiry |
Protease-20S | Active Native Streptomyces griseus Protease | +Inquiry |
MPO -27H | Active Native Human Myeloperoxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
IPMK-866HCL | Recombinant Human IPMK cell lysate | +Inquiry |
ATP5C1-8604HCL | Recombinant Human ATP5C1 293 Cell Lysate | +Inquiry |
TMEM222-963HCL | Recombinant Human TMEM222 293 Cell Lysate | +Inquiry |
TBCD-1744HCL | Recombinant Human TBCD cell lysate | +Inquiry |
CNKSR3-001HCL | Recombinant Human CNKSR3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All nodE Products
Required fields are marked with *
My Review for All nodE Products
Required fields are marked with *
0
Inquiry Basket